(data stored in ACNUC7421 zone)

EMBL: CP001111.PE313

CP001111.PE313       Location/Qualifiers
FT   CDS_pept        379985..380575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0313"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: xom:XOO_3917 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50018"
FT                   /db_xref="GOA:B4SHH5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH5"
FT                   /protein_id="ACF50018.1"
FT                   /translation="MSEAPASTPSPSAGLPRLIGVAVAVFLLTFSLVPLYRIACEKVFG
FT                   VRLERGPGSEASTGAVTGKRTVRVEFDGGVNSRLPWSFHPEQLTMDVVPGELNEALYFA
FT                   RNDSQQAVVGSAVPSVAPARASGFFSKTECFCFTAQTLQAGEKRDMPVRFIVDPDLPPE
FT                   IKTITLSYTFYRNDALSDRLAPAATSEGAHAAP"
     atgagcgagg cgccggccag cacaccgtca cccagtgccg ggctgccgcg cctgatcggc        60
     gtggcggtgg cggtgttcct gctcacgttc tcgctggtgc cgctgtaccg tatcgcctgc       120
     gagaaggtat tcggcgtgcg cctggagcgc ggtcccggca gcgaggccag taccggcgcc       180
     gtgaccggca agcgcaccgt gcgcgtggaa ttcgatggcg gggtcaactc acggctgcca       240
     tggtcgttcc atcccgagca gctgaccatg gacgtggtgc ccggcgaact caacgaagcg       300
     ctgtacttcg cccgcaacga cagccagcag gcagtggtcg gcagcgcggt gccttcggtg       360
     gcgccggcgc gcgcgtcggg tttcttcagc aagaccgagt gcttctgctt caccgcgcag       420
     acgctgcagg ccggcgagaa gcgcgacatg ccggtgcgct tcatcgtcga tccggacctg       480
     ccgccggaga tcaagacgat caccctgtcc tacaccttct accgcaacga cgcgctgtcc       540
     gatcggctgg ctccggccgc cacctcggaa ggcgcgcacg ccgcaccctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page