(data stored in ACNUC7421 zone)

EMBL: CP001111.PE315

CP001111.PE315       Location/Qualifiers
FT   CDS_pept        complement(381486..381704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50020"
FT                   /db_xref="GOA:B4SHH7"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH7"
FT                   /protein_id="ACF50020.1"
FT                   /translation="MSDSLKTLLVIAFLIVIVWNLGAGLYYLLVDRGQTKRTVNALTRR
FT                   IGVSVALIVLVIVSIYMGWIKPHGIGG"
     atgagtgatt cgctgaagac cctgctggta atcgcgtttc tgatcgtcat cgtctggaat        60
     ctgggcgccg gcctgtatta cctgctggtc gaccgcggcc agaccaagcg cacggtcaac       120
     gcactgacac gccgcatcgg ggtgtcggtg gccttgatcg tactggtgat cgtgagcatc       180
     tacatgggct ggatcaaacc gcacggtatc ggcggctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page