(data stored in ACNUC7421 zone)

EMBL: CP001111.PE316

CP001111.PE316       Location/Qualifiers
FT   CDS_pept        381762..382490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50021"
FT                   /db_xref="GOA:B4SHH8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH8"
FT                   /protein_id="ACF50021.1"
FT                   /translation="MMRQHTRVIGWLLALLAMAGFSALGLWQLQRMHAKQAMLDAQGPA
FT                   VAQALPLAQALAQALAAPGALHGVADHGRFLPGVVLLDNQTRHGRAGVKIYRPFRSDGG
FT                   SVLLVDLGWRALPPDRTLPDVPAPPSPVAVRGLLAPPPSAGLALGPAFSATDEAGRWLA
FT                   SRLPAEGLAQALGLPALPDRVLRLDPALPFGDERDLDLLPNTLPPQRHLGYAVQWFGLA
FT                   LTVLVVALVLEWRRRRPIAR"
     atgatgcgcc agcacacgcg cgtgatcgga tggctgctgg cgctgctggc gatggccggt        60
     ttcagcgcat tggggctgtg gcagctgcag cgcatgcatg ccaaacaggc aatgttggat       120
     gcgcagggtc cagccgtggc acaggcgctg ccactggcgc aggctctggc gcaggctctg       180
     gcggcgcccg gcgcgttgca cggcgtggcc gaccacggcc gcttcctgcc cggcgtggtg       240
     ctgctggaca accagacccg gcatggtcgc gccggggtga agatctatcg tccgttccgc       300
     agtgacggag gcagcgtgct gctggtcgat ctcggctggc gcgcgctgcc gccggatcgc       360
     acgctgccgg atgtgccggc gccgccttcg ccagtggccg tgcgcgggct gctggcgccg       420
     ccgccgtcgg cgggactggc actgggtccc gcattctccg caaccgatga ggccgggcgt       480
     tggctggcca gccgcttgcc cgccgagggt ctcgcgcagg cgcttggcct gccggcatta       540
     cccgaccgcg tgctgcggct ggatccggcg ctgccgttcg gcgacgaacg cgatctggac       600
     ctgctgccga acacgctgcc gccgcagcgc cacctgggct acgccgtgca gtggttcggg       660
     ctggcgctga ccgtgctggt ggtggcgctg gtactggaat ggcgcaggag gcgccccatc       720
     gcccggtag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page