(data stored in ACNUC7421 zone)

EMBL: CP001111.PE318

CP001111.PE318       Location/Qualifiers
FT   CDS_pept        383167..384330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0318"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: xac:XAC3880
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50023"
FT                   /db_xref="GOA:B4SHI0"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI0"
FT                   /protein_id="ACF50023.1"
FT                   /translation="MSLSARPALHRNFHRLAWFAMIMTASTIMFGAFVRLSDAGLSCPD
FT                   WPTCYGQATWPQHVEETLGHPATEIRPLETHKAWREQVHRFLAGALGIEILTLALLATR
FT                   KRRFGSTAVVTACVLVAAGIPLYMMGWHGTASALALIGEAILLIAALRWSNIDLARAAL
FT                   LTLAVVIFQALLGMWTVTLLLKPVVVMGHLLGGMLMFGLLVWMAWRATHMPITLAEAPK
FT                   LKWLLRIGVAVLVTQIALGGWVSANYAALACGGGSASLDNFPRCANQWWPQHNFVEGFT
FT                   LWRGIGVDYEGGVLDGASRIAIQMAHRMFAVVVAVYLLWLGVRLFRLPSMRGWASALIA
FT                   LLVLQVTLGILNVKLALPLEVAVAHNGVAVALLFVLVSLLARLRAPD"
     atgagccttt ccgcgcgtcc ggcgctgcac cgcaatttcc accgcctggc gtggttcgcc        60
     atgatcatga ctgcgagcac gatcatgttc ggtgcgttcg tgcgtctgtc cgatgccggc       120
     ctgagctgcc cggactggcc gacctgctat gggcaggcca cctggccgca gcatgtggaa       180
     gagaccctgg gccacccggc gacggagatc cgtccgctgg aaacgcacaa ggcctggcgt       240
     gagcaggtgc accgcttcct ggccggcgcg ctgggcatcg agatcctgac cctggcgctg       300
     ctggccacgc gcaagcggcg attcggaagc acggcggtgg tgaccgcctg cgtgctggtg       360
     gccgccggca taccgctgta catgatgggc tggcatggca cggccagcgc cctggcgctg       420
     atcggcgagg cgatcctgct gatcgccgcg ctgcgctgga gcaacatcga cctcgcccgc       480
     gctgcgttgc tgaccttggc ggtggtgatc ttccaggccc tgctgggcat gtggacggtg       540
     accctgctgc tgaagccggt ggtggtgatg ggccatctgc tgggcggcat gctgatgttc       600
     ggcctgctgg tgtggatggc gtggcgcgcc acgcacatgc cgatcaccct ggccgaagca       660
     ccgaagctga agtggctgct gcgcatcggc gtggcggtgc tggtcaccca gatcgcactg       720
     ggcggttggg tcagcgccaa ctacgcggcg ctggcctgcg gcggcggcag tgcctcgctg       780
     gacaacttcc cgcgctgcgc caaccagtgg tggccgcagc acaatttcgt cgagggcttc       840
     accctgtggc gcggcatcgg cgtggactac gaagggggcg tgctggatgg cgcctcgcgt       900
     atcgccatcc agatggcgca ccgcatgttc gcggtggtgg tggccgttta cctgctgtgg       960
     ctgggcgtgc gcctgttccg gttgccgagc atgcgtggct gggccagcgc gctgatcgcg      1020
     ctgctggtgc tgcaggtcac cctcggcatc ctcaatgtaa agctggcgct gccgctggaa      1080
     gtggcggtgg cccacaacgg cgtggccgtt gccctgttgt tcgtgctggt cagcctgctg      1140
     gcccgcctgc gtgccccgga ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page