(data stored in ACNUC7421 zone)

EMBL: CP001111.PE320

CP001111.PE320       Location/Qualifiers
FT   CDS_pept        385420..386241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1009 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50025"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI2"
FT                   /protein_id="ACF50025.1"
FT                   /translation="MHSIFRWTTALLLALGMALNAHADDTAAQIRQHAGDHRLLVLGEF
FT                   HGTRETPLLVRELMEAYAADGAPVRLALELPTDENAALATYMASAGTARARAALRGTTY
FT                   WNVRSRMHDGRRNEDMLDLIEAVRVLRSQGRDVQVFGFDRVLPAEMAGTGARDRVMAEE
FT                   VRARAQVLPKKGRLLVLTGNVHGMRTQPKAIAYPPMTALLKDLDLYNVRIEARGGEGWG
FT                   CTAVQRCGARQLGSHEGASPRLDTDADRSYDLWVWLPRFSVARLLDSASVW"
     atgcattcga tcttccgctg gaccactgcg ttgctgctgg cgctcggcat ggcccttaat        60
     gcgcatgccg atgacaccgc cgcgcagatc cgccagcatg ccggtgacca tcgcctgctg       120
     gtgctgggtg agttccacgg tacccgcgag acgccgctgc tggtacggga actgatggag       180
     gcctacgcgg ccgatggtgc accggtgcgg ttggctttgg agctgccgac tgacgagaac       240
     gccgcgctgg cgacctatat ggcgtctgcc ggcacggccc gagcgcgggc tgcattgcgt       300
     ggcacgacgt actggaacgt ccgcagccgg atgcatgacg gccgccgcaa cgaagacatg       360
     ctcgacctga tcgaagcggt acgcgtactg cgtagccaag gccgcgacgt gcaggtgttc       420
     ggcttcgacc gcgtgcttcc cgccgaaatg gccggcaccg gcgcgcgtga ccgggtgatg       480
     gccgaagaag tacgggcacg agcgcaggtg ctgccgaaga aagggcggct gctggtgctg       540
     accggcaacg tgcatggcat gcgcacgcag ccgaaggcga ttgcgtaccc gccgatgacc       600
     gcgctgctga aggatctgga tctttacaac gtgcgtatcg aggcgcgtgg tggggaaggc       660
     tggggatgta ccgccgttca gcgctgcgga gcacgtcagc tgggcagcca tgaaggtgca       720
     tcgcccagac tggataccga cgccgaccgt agttacgacc tgtgggtgtg gctgccgcgc       780
     ttcagtgtgg cgcggctgct ggacagcgct tcggtctggt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page