(data stored in ACNUC7421 zone)

EMBL: CP001111.PE321

CP001111.PE321       Location/Qualifiers
FT   CDS_pept        complement(386374..387345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0321"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: xcb:XC_3894
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50026"
FT                   /db_xref="GOA:B4SHI3"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI3"
FT                   /protein_id="ACF50026.1"
FT                   /translation="MTRWWSRLRPDNFTLALLCTVGLASLLPMKGAAAIVLDDVTTVAI
FT                   AALFFLHGARLPRESIIGGMLHWRLHLTILACTFILFPLLGLMVKPLSGWLLTPELYLG
FT                   VLFLCTLPSTVQSSIAFTSMARGNVPAAVCSASLSSILGVFLTPLLLTALAGTSGGVHD
FT                   PLHAIGGIMLQLLVPFVAGHLLRPWIAGWVEKQRALLRYTDQATILLVVYSAFGEAVTE
FT                   GLWSKTPLLSLLAVAVVAAVLLGIAMPLITFIARRLRFNREDEIAIVFCGSKKSLATGV
FT                   PIAKVLFAGGSLGAIVLPVMIYHQIQLIVCGVIAQRYARRKP"
     atgacccgct ggtggtcgcg cctgcgaccg gacaacttca ccctcgccct gctgtgcacc        60
     gtcggcctgg cctcgctgct gccgatgaag ggcgccgccg ccatcgtgct cgacgatgtc       120
     accaccgtcg ccatcgccgc gctgttcttc ctgcatggcg cgcgcctgcc gcgcgagtcg       180
     atcatcggcg gcatgctgca ctggcggctg cacctgacca tcctggcctg caccttcatc       240
     ctgttcccgc tgctggggct gatggtcaag ccactgtcgg gctggctgct gaccccggag       300
     ctgtacctgg gcgtgctgtt cctgtgcacc ctgccctcca ccgtgcagtc gtccatcgcg       360
     ttcacctcga tggcacgcgg caacgtgcct gcggcggtat gcagcgcgtc gctgtcgagc       420
     atcctcggtg tgttcctgac gccgctgctg ctgaccgcgc tggccggtac ctccggcggc       480
     gtgcacgacc cgctgcacgc gatcggcggc atcatgctgc agctgctggt gccgttcgtg       540
     gccggccacc tgctgcggcc gtggattgcc ggctgggtgg agaagcagcg cgcgctgctg       600
     cgctacaccg accaggccac catcctgctg gtggtgtact ccgcgttcgg cgaagcggtg       660
     accgaagggc tgtggagcaa gacaccgctg ctgtcgctgc tggccgtggc ggtggtcgcc       720
     gccgtgctgc tcggcatcgc catgccattg atcaccttca tcgcccgtcg cctgcgcttc       780
     aaccgcgagg acgagatcgc catcgtgttc tgcggctcga agaagagcct ggccaccggc       840
     gtgccgatcg ccaaggtgct gttcgccggc ggcagtctcg gtgccatcgt gctgccggta       900
     atgatctacc accagatcca gttgatcgtc tgcggcgtga tcgcgcagcg gtacgcgcgg       960
     cgcaagccct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page