(data stored in ACNUC7421 zone)

EMBL: CP001111.PE322

CP001111.PE322       Location/Qualifiers
FT   CDS_pept        complement(387374..387874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0322"
FT                   /product="protein of unknown function DUF442"
FT                   /note="PFAM: protein of unknown function DUF442; KEGG:
FT                   xcb:XC_3893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50027"
FT                   /db_xref="GOA:B4SHI4"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI4"
FT                   /protein_id="ACF50027.1"
FT                   /translation="MLLRLTCLLLLSLCLPLTALAEDAPLNEVRPGLYAGGQPSATQLQ
FT                   ALAAQGVRTVIDLRQPDEDRGFDETRVAESLGLRYVRIPVAGADGLDAANIRAVHQALQ
FT                   QSQGPVLLHCASGNRAGAVLGLINARYEHASPEQALQLGQRAGLKSLEAATRQRLATPV
FT                   TSP"
     atgctgctgc gtctgacctg cctgctgttg ttgtcgctct gcctgccgct gacggccctg        60
     gccgaagacg cgcccctgaa cgaagtccgc cccggcctgt atgccggcgg ccaacccagc       120
     gccacacagc tgcaggccct ggccgcgcag ggcgtgcgca ccgtgatcga cctgcgccag       180
     cccgacgaag accgcggctt cgatgaaacc cgcgtggccg aatcactggg tctgcgctac       240
     gtacgcattc cggtggccgg cgccgacggc ctggatgcag ccaacatccg tgccgtgcac       300
     caggccctgc agcagagcca ggggccggtg ctgctgcact gcgcctccgg caaccgcgcc       360
     ggtgccgtgc tcggcctgat caatgcacgc tacgaacacg ccagcccgga acaggccctg       420
     cagctcggcc agcgtgccgg cctgaagtcg ctggaagccg ccacccgcca gcgcctggcc       480
     acgccggtca cctcgccctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page