(data stored in ACNUC7421 zone)

EMBL: CP001111.PE323

CP001111.PE323       Location/Qualifiers
FT   CDS_pept        complement(387903..389642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0323"
FT                   /product="DNA primase"
FT                   /note="KEGG: xac:XAC3876 DNA primase; TIGRFAM: DNA primase;
FT                   PFAM: zinc finger CHC2-family protein; TOPRIM domain
FT                   protein; DNA primase DnaG DnaB-binding; DNA primase
FT                   catalytic core domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50028"
FT                   /db_xref="GOA:B4SHI5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI5"
FT                   /protein_id="ACF50028.1"
FT                   /translation="MARIPDAFIDDLLARSDIVEVVGSRVPLKRQGKEYAARCPFHDER
FT                   SASFTVSPTKQFYHCFGCGAHGTAISFLMNYDRLEFLDAVDELAKRAGMEVPRSENPRS
FT                   PQQQDDSRELYSALEAATKFFQSNLQGSDKARSYLDGRGVDEENRARFQIGYAPDGYSG
FT                   LRDALGKDERRMKLLDRAGLFSKNDRGHVYDKFRDRVMFPIFDRRGRVIAFGGRVFEKD
FT                   DGPKYLNSPETALFHKGRELYGLWQVRQANQKIERLIVVEGYMDVVSLFQFGVTQAVAT
FT                   LGTATTPDHAELLFRNAPDVFFCFDGDAAGRRAGWKALESVLPRMKDGRQAFFLFLPDG
FT                   EDPDTIVRKEGAEAFNERLKQATPLSQFFFDELTREINLGTLDGKARLAERAKPMLAQI
FT                   PDGAFGDLMKQQLAQLTGLGGNAQAARAPMPQRQPSRAIQPVAKRSLVRGAIAVLLQQP
FT                   SLALTLGGKHHFQGLRLPGVELLLELLDLVEQRPDISTGALLEHFDGREEQASLHTLAA
FT                   QTMPGDDAMWTQELHDAVAQLEKQLLVQRLEELLAKQRQQGLDDTDKYELRELLKARAG
FT                   LRL"
     atggcccgta tccccgacgc tttcatcgac gacctgctcg cccgctccga catcgtcgag        60
     gtggtgggca gccgcgtgcc gttgaagcga cagggcaagg aatacgcagc gcgttgcccg       120
     ttccatgacg agcgctcggc gtcgttcacg gtctcgccca ccaagcagtt ctatcactgc       180
     ttcggctgtg gcgcgcacgg caccgcgatc agcttcctga tgaactacga ccgcctcgaa       240
     ttcctcgacg cggtggatga actggccaag cgcgcaggca tggaagtgcc gcgcagcgag       300
     aatccgcgca gcccccagca gcaggacgac agccgcgagc tgtactcggc gcttgaggcg       360
     gccacgaagt ttttccagag caacctgcag ggcagcgaca aggcccgcag ctacctggat       420
     ggccgtggcg tggatgaaga gaaccgcgcg cgcttccaga tcggctacgc accggatggc       480
     tacagcggcc tgcgcgatgc actgggcaag gacgagcggc ggatgaagct gctcgaccgc       540
     gccggcctgt tctccaagaa cgatcgcggt cacgtctacg acaagttccg cgaccgggtg       600
     atgttcccga tcttcgaccg ccgcggccgg gtgatcgcct tcggtggccg cgtgttcgaa       660
     aaggacgacg gccccaagta cctcaactcg ccggaaaccg cgctgttcca caagggccgc       720
     gaactgtacg gcctgtggca ggtgcgccag gccaaccaga agatcgagcg gctgatcgtg       780
     gtcgagggct acatggacgt ggtctcgctg ttccagttcg gggtcaccca ggcggtggcg       840
     acgctgggta ccgcaaccac gccggaccat gccgagctgc tgttccgcaa cgcgccggat       900
     gtgttcttct gcttcgatgg cgacgccgcc ggccgccgcg ccggctggaa ggcgctggag       960
     tcggtgctgc cgcgcatgaa ggatggccgc caggccttct tcctgttcct gcccgatggc      1020
     gaagacccgg acaccatcgt gcgcaaggaa ggcgccgaag ccttcaacga acgcctgaaa      1080
     caggccacgc cgctgtcgca gttcttcttc gacgagctca cccgcgaaat caacctgggc      1140
     acgctcgatg gcaaggcgcg cctggccgag cgcgcaaagc cgatgctggc gcagattccc      1200
     gacggcgcct tcggcgacct gatgaagcag cagctggcgc agctgaccgg ccttggcggc      1260
     aatgcccagg cagcgcgcgc accgatgccg caacgccagc cctcgcgagc gatccagccc      1320
     gtggccaagc gcagcctggt acgcggcgcg atcgccgtac tgctgcagca gccgtcgctg      1380
     gcgctgacgc tgggcggcaa gcaccacttc cagggcctgc gcctgccggg cgtggagctg      1440
     ctgctggagc tgctggacct ggtcgagcaa cgtccggaca tcagcaccgg cgcactgctg      1500
     gagcacttcg acgggcgtga ggagcaggcg tcactgcaca cgctggccgc gcagacgatg      1560
     cccggcgacg acgcgatgtg gacccaggaa ctgcacgatg ccgtggccca gctggagaaa      1620
     cagctgctgg tgcaacgtct ggaggagttg ttggcaaagc agcgccaaca gggtctggac      1680
     gatactgaca aatacgaact gcgcgagctg ctgaaagcgc gggccggact gcgcctgtag      1740
//

If you have problems or comments...

PBIL Back to PBIL home page