(data stored in ACNUC7421 zone)

EMBL: CP001111.PE328

CP001111.PE328       Location/Qualifiers
FT   CDS_pept        complement(392872..393537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0328"
FT                   /product="protein of unknown function DUF1526"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   pst:PSPTO_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ0"
FT                   /protein_id="ACF50033.1"
FT                   /translation="MTMAPHDVLRRALSAERLSTYERIASTCSPDVTAESLYLWNMRMC
FT                   GALMMPVHLCEVVTRNAAATVLARQHGPRWPWNDAFRRRLPTSSCTSARAALEHVAGRT
FT                   TDTPEIVAKLPMVFWQQLFTCRFDDTLWIPALNGVLRHAPSAHPSVIRKAIHADIGRIR
FT                   HLRNRIAHHEPILERDIGADLAAIGRLIHARCPHTLGWLQRHERATTVLAASPLAGRP"
     atgacgatgg ctccacacga tgtactgcgg cgcgcgttgt cagcggagcg tctgtctact        60
     tacgagagaa tcgcatcgac ctgcagcccc gacgtcacgg ccgaatctct gtacctctgg       120
     aacatgcgga tgtgcggtgc actgatgatg ccggtccatc tgtgcgaagt ggtcacccgt       180
     aacgccgctg ctaccgtgct cgcccggcag catggcccgc gttggccttg gaatgatgcc       240
     ttccgacgca ggctgccaac ctcgtcctgt acttccgcac gtgcagcact ggaacacgtt       300
     gctggccgca cgaccgatac acccgaaatc gtcgccaagc tgccgatggt gttctggcag       360
     cagcttttca cctgtcgctt cgacgacacg ctgtggatac ccgcactcaa tggagttctg       420
     cggcatgcac cctcagctca tcccagcgtc atcagaaaag ccatccacgc tgacatcgga       480
     cgcattcgcc acctgcgcaa ccgcatcgcg caccacgaac ccatcctgga acgcgacatc       540
     ggtgccgacc tggcggcgat cggacggctg atccacgccc gctgcccgca tacgctgggc       600
     tggctgcagc gccatgagcg ggcgacaacg gtgttggccg cgtcgccgtt ggcagggcgt       660
     ccgtaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page