(data stored in ACNUC7421 zone)

EMBL: CP001111.PE334

CP001111.PE334       Location/Qualifiers
FT   CDS_pept        400160..400612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0334"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   xcb:XC_3884 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50039"
FT                   /db_xref="GOA:B4SHJ6"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ6"
FT                   /protein_id="ACF50039.1"
FT                   /translation="MNAPIIHRPSPAFIAASWVALLLGAVAYLVGLFNAEMPLNEKGYY
FT                   LTLLLFGLFAAVSLQKSVRDRVEGIPVSGLYYALCWFALLSALLLLLVGLWNATLVLSE
FT                   KGFYGMAYALSLFGAVAVQKNTRDLIAAGGGESKRSAGVPPLPEQE"
     atgaacgcac cgatcatcca tcgaccctcg ccggccttca ttgccgcctc ctgggtggcc        60
     ctgctgctcg gcgcggtggc ctacctggta ggcctgttca atgcggagat gccgctgaac       120
     gagaagggct attacctcac cctgctgctg tttggcctgt tcgcagcggt gtcgctgcag       180
     aagagcgtgc gcgaccgtgt cgagggcatt ccggtgagtg gcctgtatta cgcgctgtgc       240
     tggttcgcct tgctgtctgc gctgttgttg ctgctggttg gcctgtggaa cgccaccctg       300
     gttctgagcg agaagggctt ctacggcatg gcctatgcgc tgtcgctgtt cggcgcggtg       360
     gcggtgcaga agaacacccg tgacctgatc gccgccggtg gcggtgaaag caagcgcagt       420
     gcgggcgtcc cgccgctgcc ggaacaggag tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page