(data stored in ACNUC7421 zone)

EMBL: CP001111.PE335

CP001111.PE335       Location/Qualifiers
FT   CDS_pept        complement(400665..400994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50040"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ7"
FT                   /protein_id="ACF50040.1"
FT                   /translation="MAEYQIPGRVPDDSTPRDAVSNYWRERYTSEPYYDDQLFFDDYEP
FT                   AYRIGHSARAQDMIRAYEEMEGELESRWASERGKSRLEWAQARNAVRRGWEEAQQVEPR
FT                   LARGP"
     atggccgaat accagatccc cggccgcgtg ccggacgaca gcacgccgcg cgacgcggtc        60
     agcaactact ggcgcgagcg ctatacctct gaaccgtact atgacgacca gctgttcttc       120
     gacgactacg aaccggccta ccgcatcggc cactcggccc gcgcgcagga catgatccgc       180
     gcctacgagg aaatggaggg cgaactggaa tcacgctggg ccagcgaacg tggcaagagc       240
     cggctggagt gggcgcaggc gcgcaatgcc gtgcgccgtg gctgggagga agcgcagcag       300
     gtggaaccgc gcctggcacg cggcccctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page