(data stored in ACNUC7421 zone)

EMBL: CP001111.PE337

CP001111.PE337       Location/Qualifiers
FT   CDS_pept        complement(402401..403162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50042"
FT                   /db_xref="GOA:B4SHJ9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ9"
FT                   /protein_id="ACF50042.1"
FT                   /translation="MNSLARLATTALLLAAAMSAYAAPLDGARQLIVVTSDNWSSTQGQ
FT                   LQAYERDGKGWRTHGQGFPVALGRTGSAWGLGLHPAQGDGPQKQEGDGRSPAGVFALGS
FT                   AFGYAITRPRTAMAYQPMLESSYCMDVPGSPFYNRIVDAKKVGSAAIKGSTEPMRLDLH
FT                   NKGDVRYQEGFVIAHNPDNQPGKGSCIFAHLWRAPGEATAGCTAMPQARMQALLDWLRP
FT                   QDTPRFVLLPRAEYTRLQAQWQLPALSGDAR"
     atgaattcgc tggcccgtct cgccaccact gcgctgctgc ttgccgctgc gatgtccgcc        60
     tacgctgcgc cgctcgatgg tgcacgccag ctgatcgtgg tcaccagcga caactggagc       120
     agcacccagg ggcagctgca ggcctatgaa cgcgacggca agggctggcg cacgcacggg       180
     cagggcttcc cggtcgcgct cggccgtacc ggcagcgcgt ggggtctggg cctgcatccg       240
     gcgcagggcg atggcccaca gaagcaggaa ggcgatggcc gcagcccggc cggcgtattc       300
     gcgctcggca gcgccttcgg ctatgccatc acccgccccc gaactgcgat ggcctaccag       360
     cccatgcttg aaagcagcta ctgcatggat gtgcccggtt caccgttcta caaccgcatc       420
     gtcgatgcga agaaggtcgg cagcgccgcg atcaagggct ccaccgagcc gatgcggctg       480
     gacctgcaca acaagggcga cgtgcgttac caggaaggct tcgtgattgc ccacaacccg       540
     gacaaccagc ccggcaaggg cagctgcatc ttcgcccatc tgtggcgcgc gcccggtgag       600
     gccacggccg gctgcaccgc catgccgcag gcacgcatgc aggcgctgct ggactggctg       660
     cggccgcagg atacgccgcg cttcgtgctg ctgccgcgcg ccgagtacac gcgcctgcag       720
     gcacagtggc agctgcccgc actgagcgga gacgcccgtt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page