(data stored in ACNUC7421 zone)

EMBL: CP001111.PE338

CP001111.PE338       Location/Qualifiers
FT   CDS_pept        complement(403178..404026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0338"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: sdy:SDY_2751 putative DNA-binding
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50043"
FT                   /db_xref="GOA:B4SHK0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK0"
FT                   /protein_id="ACF50043.1"
FT                   /translation="MPPLLKIRSERGQMSAIERRIADFILDNAHLLRDYSSQQLASALG
FT                   ISQSSVVKFSQKLGFKGYPDLKYSIGQDVARAGADPQQAPSEPDSGDDYLRLGEALRRS
FT                   KAQAEEETRQANPREEIERIVQLLDGAPKLFVYGLGDDGLYAREFAMRLSLLGLLVVPH
FT                   TDPILMLANLSAARPGDVLLMFSEFGNLPQLSQLSRQFQDMGGKVISITRHTANPLRAH
FT                   ADAALAVCAHDRTPQVAQLLYRSAMHALLDFLFVLLCHANPDRQQQLAVNLERIDHLLD
FT                   S"
     atgccgcccc tgctgaagat ccgttccgag cgcgggcaga tgtcggccat cgagcgccgc        60
     atcgccgact tcatcctcga caacgcccac ctgctgcgcg actactcgtc ccagcagctg       120
     gccagcgcgt tgggcatcag ccagtccagc gtggtgaagt tcagccagaa gctcggcttc       180
     aagggctacc cggacctgaa atactccatc ggtcaggacg tggcccgcgc gggtgccgac       240
     ccgcaacagg cgcccagcga accagacagc ggtgacgact acctgcgcct gggcgaggcc       300
     ctgcgccgca gcaaggcaca ggccgaggag gaaacccgcc aggccaatcc gcgcgaggag       360
     atcgagcgca tcgtgcagct gctcgatggg gcaccgaagc tgttcgtgta cggactgggt       420
     gatgacggcc tgtacgcgcg tgagttcgcc atgcggctgt cgctgctcgg gctgctggtg       480
     gtgccgcata ccgacccgat cctgatgctg gccaacctgt cagcggcacg cccgggtgac       540
     gtgctgttga tgttctccga gttcggcaac ctgccccagc tgtcgcagct gtcgcggcag       600
     ttccaggata tgggcggcaa ggtgatttcc attacccgcc acaccgccaa cccgctgcgc       660
     gcgcatgctg atgccgcgct ggcggtgtgc gcgcacgacc gcacgccgca ggtcgcgcag       720
     ctgctgtacc gtagcgccat gcacgcgctg ctcgatttcc tgttcgtgct gctctgccac       780
     gccaatccgg accgccagca gcaactggcg gtgaacctgg agcggatcga ccacctgctg       840
     gattcctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page