(data stored in ACNUC7421 zone)

EMBL: CP001111.PE339

CP001111.PE339       Location/Qualifiers
FT   CDS_pept        complement(404448..405542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0339"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: xcv:XCV3980 putative chloromuconate
FT                   cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50044"
FT                   /db_xref="GOA:B4SHK1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK1"
FT                   /protein_id="ACF50044.1"
FT                   /translation="MKITAIELGMLRVPLKTPFKTALRTVETVEDVVVLIRTDTGHTGY
FT                   GEAPATAVITGDTHGSIIEAIRHFIAPRLIGQDVVNLNHLCTLVQTAMERNSSAKAAVE
FT                   IALYDLWAQLHGAPLYQMLGGGDPVITTDITISVDYIDKMVADSLSAIERGFESLKIKV
FT                   GKDIGLDIERVKAIHAAVEGRALLRLDANQGWTAKQAVHAMRTLEEAGVVLELLEQPVK
FT                   AADISGLKYVTDRVNTPVMADESVFSPSQVMDLIQQRAADIINIKLMKTGGLSNAIRIA
FT                   DIAGIYGVPCMIGCMIESSISVAAAVHLAVAKSDVITKVDLDGPSLGQFDPVSGGVHFN
FT                   ESEISISDVPGLGITEVRGLEMLG"
     atgaagatca ctgccatcga actgggcatg ctgcgcgtgc cgctgaaaac accgttcaag        60
     accgccctgc gcacggtgga aaccgtggaa gacgtggtgg tgctgatccg caccgatacc       120
     ggccacaccg gctatggcga agcaccggcc accgcggtga tcaccggtga tacccacggc       180
     tcgatcatcg aggcgatccg ccacttcatc gcgccgcgcc tgatcggcca ggacgtggtc       240
     aacctcaacc atctgtgcac gctggtgcag accgcgatgg agcgcaacag cagtgccaag       300
     gcggcggtgg agatcgcgct gtacgacctg tgggcacagc tgcatggcgc gccgctgtac       360
     cagatgctgg gcggcggcga cccggtgatc accaccgaca tcaccatcag cgtggactac       420
     atcgacaaga tggtggctga ctcgctgtcg gcgatcgaac gcggcttcga gtcgctgaag       480
     atcaaggttg gcaaggacat cggtctggac atcgaacggg tcaaggcaat ccacgccgcc       540
     gtggaaggcc gcgccctgct tcggctggat gccaaccagg gctggaccgc caagcaggcg       600
     gtgcatgcga tgcgcacact ggaagaggcc ggcgtggtgc tggagctgct ggagcagccg       660
     gtgaaggcgg ccgacatcag tggcctgaag tacgtgaccg accgcgtcaa cacgccggtg       720
     atggccgacg aaagcgtgtt cagcccgagc caggtgatgg acctgatcca gcagcgcgcg       780
     gccgacatca tcaacatcaa gttgatgaag accggcggcc tgtccaacgc gatccgcatc       840
     gccgacatcg ccggtatcta cggtgtgccc tgcatgatcg gctgcatgat cgaatcgagc       900
     atcagcgtgg ccgcggcggt gcacctggcg gtggccaaga gcgatgtgat caccaaggtc       960
     gacctcgacg gcccctcgct gggccagttc gacccggtca gtggcggcgt gcacttcaac      1020
     gaatcggaga tcagcatcag cgacgtgccg gggctgggca tcaccgaagt gcgcgggctg      1080
     gagatgctgg gttga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page