(data stored in ACNUC7421 zone)

EMBL: CP001111.PE34

CP001111.PE34        Location/Qualifiers
FT   CDS_pept        39662..40405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49739"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR38"
FT                   /protein_id="ACF49739.1"
FT                   /translation="MKVCLAPVIALLAAALMPAAAGASPQTANAQPLALSCGATEFVGM
FT                   TSNSSTLAKRQCNGGYVYGIGVSVNEAVENLNGFMAVLQAGVSCSANASSIVSGAYGKG
FT                   VFAQFVCNGWPIAGVGNSPTTAARNSLAIATEMAATGTHCAAPLNGSYYPEAWGFRFRY
FT                   DCGNTQTLKSWSIAGLGASVDDANVIAMRLMRYTTAAGQSCDFERAEINGVILKATLVC
FT                   NGSYIQGYGSSVTAAANDALAQIGA"
     atgaaagtct gccttgctcc tgtcattgcc ctgcttgctg ctgccctgat gccggccgct        60
     gcaggagctt ccccccagac cgccaacgcc caacctttgg cgttgagttg cggcgccacc       120
     gaattcgtcg gcatgaccag caactcgtca acgctggcca agcgccaatg caacggtggc       180
     tatgtctatg ggatcggtgt ttcagtcaac gaagccgtgg agaatctcaa cggcttcatg       240
     gcagtgctgc aggccggcgt gagctgcagt gcgaatgcca gcagcatcgt cagtggtgct       300
     tacggcaaag gtgttttcgc ccagttcgtc tgcaacggct ggccgatagc cggtgtaggc       360
     aactcaccca ccactgcggc gcgcaactcg ctggccatcg ctacggaaat ggcggccacg       420
     ggtacccatt gcgccgcgcc actgaatggt tcgtactatc cagaagcctg gggattccgt       480
     ttccgctacg actgcggcaa cacacagacc ctgaagagct ggtccatcgc tgggctcggc       540
     gccagcgtcg atgacgccaa cgtcatcgcc atgcgcctga tgcgctatac gacagctgcg       600
     ggccagagct gcgacttcga gagggctgaa atcaatggcg tcattctgaa ggccacgctg       660
     gtctgcaatg gctcatacat ccagggctac ggcagttcgg tcaccgccgc ggccaacgat       720
     gcactggccc agatcggtgc ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page