(data stored in ACNUC7421 zone)

EMBL: CP001111.PE342

CP001111.PE342       Location/Qualifiers
FT   CDS_pept        408653..411676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0342"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: saz:Sama_3060 TonB-dependent receptor,
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50047"
FT                   /db_xref="GOA:B4SHK4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK4"
FT                   /protein_id="ACF50047.1"
FT                   /translation="MKAYTIKRAALCVALGACLGAMLPSIALAQNVSGAVAGRATAGDQ
FT                   VTVVSSSTGLTRTVTVGADGSYRLGQLPVGDYQLQLSREGQALGDQVAVSVAVGGTTTV
FT                   NLASGGGVTNLDALQVRGTRVINRVDVYSTETSFNINRQEISRLPVAQDLSAVALMAPG
FT                   VVGGNSSFGGLSFAGSSVAENAVFINGLNVTDMYTRRGFSTAPFAFFNEFQVKTGGYSV
FT                   EFGRSTGGVINAVTRSGSNVFEGGVEVTAEPSAWRSSGGDHFHRDGTPHSYGSRDNNSF
FT                   LKTNVWGSGPIIKDKLFLFAMYEDRSDKGHNTSSDGSTWFKNDSGNGFWGTKLDWNIND
FT                   NHSLALLAFSDEGDVTNASYGYNWNNDRLGAWGGDSITETGGRNWSATYTGHFGQNFTA
FT                   RAMVGQNKQRAFTNSSLDQACSPVFTDSTYGPRLGKLQGLRAGCHPTGTAVAERDDTRD
FT                   VARLDFEWQLGDHLLRFGVDRELMTTDQSTRYPGPTALSYTAYVARPGDEVWDGANAYV
FT                   PAGVTEMLRARNRQSGGKFETEANAFYLEDIWNITPNLMLNLGVRWDRFENRTAAGKAF
FT                   IKMDDLIAPRVGFSWDMRGDGSTKLFGNAGRYYLPVTNNINVNFAGGLTDEYSYYVLNG
FT                   WEQKTSPTGSPYMAPIVGQQIGPTDTRMNTGGADLRQSVDRDLKAVYQDEYILGFQNMI
FT                   NQAWSWGVNATYRRMTRALDDIRINYTPCGPTPSTLWPIANPGESLTIWGDKSIGCANE
FT                   GWITIDTANSGYRKGGSGEVIGYSKPKRTYKALEFQIDRAWDEKWMLNASYLWSKSEGN
FT                   FEGPVNSDTNYGDTGMVQFWDHPATNERYGVLFNDFRHQFKLRAAYALNKQWSFGTTLQ
FT                   VQSGGPITAYGVMWPNDSIAGGSTSSEGSGGGTGWLCVANCSGPYDKRQFEYSPRGAFG
FT                   RLPWTWTMGANVTWRLPVEGIDLSARLSVYNLFNNQKTINVHQRYEAQPGQYREATFAT
FT                   GTRWQAPRYTQLVVTWNF"
     atgaaggctt acaccatcaa gcgggcggcg ttgtgcgtcg ccctcggggc gtgcctgggc        60
     gcgatgctgc ccagcatcgc gttggcacag aatgtcagtg gcgccgtggc cggccgtgcc       120
     accgccggcg accaggtcac cgtggtcagc agcagtaccg gcctgacccg caccgtcacc       180
     gtcggtgccg atggcagtta ccgcctgggt caattaccgg taggcgacta ccagctgcag       240
     ctcagccgtg agggccaggc gctgggcgat caggtcgcgg tcagcgtcgc cgtcggtggc       300
     accaccacgg tcaacctggc aagtggtggc ggtgtcacca atctcgatgc actgcaggtg       360
     cgcggcaccc gcgtgatcaa ccgcgtggat gtctactcca ccgaaacctc gttcaacatc       420
     aaccgccagg agatctcacg gctgccggta gcgcaggacc tgtccgcggt cgcgctgatg       480
     gcaccgggcg tggtgggggg caattcgtcg tttggtggcc tgtcgttcgc cggctcctcg       540
     gtggccgaga acgctgtctt catcaacggc ctcaatgtca ccgacatgta cacccggcgc       600
     ggcttcagta ccgcgccatt cgccttcttc aacgagttcc aggtcaagac cggtggctac       660
     tcggtcgagt tcggccgctc caccggcggc gtgatcaatg cggtgacccg ttcgggcagc       720
     aacgtgttcg aaggcggcgt ggaagtgacc gctgaaccga gcgcgtggcg ttccagtggc       780
     ggcgatcatt tccaccgtga cggtacgccg cattcctacg gaagccgcga caacaattcg       840
     ttcctgaaga ccaacgtctg gggttccggc ccgatcatca aggacaagct gttcctgttc       900
     gccatgtacg aggaccgcag tgacaaggga cacaacacat cgtccgatgg cagtacctgg       960
     ttcaagaatg attccggcaa cggcttctgg ggcacaaagc tggactggaa catcaacgac      1020
     aaccacagcc tggcactgct ggcgttctcc gacgagggtg acgtcaccaa tgcctcgtat      1080
     ggctacaact ggaacaacga ccggcttggc gcctgggggg gggactcgat caccgagacc      1140
     ggcggccgca actggtcggc gacctacacc ggtcatttcg ggcagaactt cactgcccgc      1200
     gccatggtcg gccagaacaa gcagcgtgcg ttcaccaact cgtcgctgga ccaggcctgc      1260
     agcccggtgt tcaccgacag cacctacggt ccgcgcctgg gcaagctgca gggcctgcgc      1320
     gccggctgcc atcccaccgg cacggcggtg gccgagcgcg atgacacccg cgacgtggcc      1380
     cgcctggact tcgagtggca gctgggcgac cacctgctgc gcttcggcgt ggaccgcgag      1440
     ctgatgacca ccgaccagtc cacccgctac ccgggaccga ccgcgctgag ctataccgcc      1500
     tacgtcgcgc ggcccggcga tgaagtgtgg gacggcgcca acgcctatgt tccggccggc      1560
     gtcaccgaga tgctgcgcgc acgcaaccgc cagtccggcg gcaagttcga gaccgaggcc      1620
     aacgcgttct acctggaaga catctggaac atcaccccga acctgatgct caacctcggt      1680
     gtgcgctggg accgtttcga gaaccgcacc gccgccggca aggcgttcat caagatggac      1740
     gacctgatcg caccgcgcgt cggcttctcg tgggacatgc gcggtgatgg cagcaccaag      1800
     ctgttcggca acgcaggccg ctactacctg ccggtgacca acaacatcaa cgtgaacttc      1860
     gccggtggcc tgaccgacga gtacagctac tacgtgctca acggctggga gcagaagacc      1920
     tcgccgaccg gctcgccgta catggcaccg atcgtcggcc agcagatcgg gccgaccgac      1980
     acccgcatga acaccggtgg cgccgatctg cgccagagcg tggaccgcga cctgaaggcg      2040
     gtctaccagg atgagtacat cctcggcttc cagaacatga tcaaccaggc ctggtcgtgg      2100
     ggcgtcaatg ctacctatcg gcgcatgacc cgcgcgctgg atgacatccg catcaactac      2160
     accccctgtg gcccgacccc gagcacgctg tggccgatcg ccaacccggg cgagagcctg      2220
     acgatatggg gcgacaagag catcggctgc gccaatgaag gctggatcac catcgatacc      2280
     gccaacagcg gctaccgcaa gggcggcagt ggcgaggtga tcggttactc caagcccaag      2340
     cgcacctaca aggcgctgga gttccagatc gaccgtgcat gggacgagaa gtggatgctc      2400
     aacgcgtcct acctgtggtc gaagagcgag ggcaacttcg agggcccggt caactccgat      2460
     accaactacg gcgacaccgg catggtccag ttctgggatc atccggccac caacgagcgc      2520
     tacggcgtgc tgttcaacga cttccgccat cagttcaagc tgcgtgccgc ctacgcgctg      2580
     aacaagcagt ggtcgttcgg caccacgctg caggtgcagt ccggtggccc gatcactgcc      2640
     tacggcgtga tgtggccgaa cgattccatc gccggtggta gtacctccag cgaaggcagc      2700
     ggcggtggca ccggctggct gtgcgtggcc aactgctcgg gcccgtacga caaacgccag      2760
     ttcgagtaca gcccgcgcgg cgcgttcggt cgcctgccgt ggacctggac catgggtgcc      2820
     aatgtgacct ggcgcctgcc ggtggagggc atcgacctca gcgcgcggct gtcggtgtac      2880
     aacctgttca acaaccagaa gaccatcaac gtgcatcagc gctatgaagc gcagccggga      2940
     cagtaccgcg aagctacctt cgcaaccggc acgcgttggc aggcgccgcg ctacacccag      3000
     ctggtggtga cctggaactt ctga                                             3024
//

If you have problems or comments...

PBIL Back to PBIL home page