(data stored in ACNUC7421 zone)

EMBL: CP001111.PE345

CP001111.PE345       Location/Qualifiers
FT   CDS_pept        414164..414535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50050"
FT                   /db_xref="GOA:B4SHK7"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK7"
FT                   /protein_id="ACF50050.1"
FT                   /translation="MNLPLHFGLLGTLEAGAIALLVGLLVYFLWSQLCRLLHWTVGHAI
FT                   GWSCVIAVIISAGIDAWKLFYMGIVRLESPLYARLFLATIHDPNELGSRVVLEIAGALA
FT                   GVALGWVMFSSRSSAQNVD"
     atgaaccttc ccctgcactt cggcctgctc ggtaccctcg aagcgggcgc catcgccctg        60
     ctggtcgggc tgctggtgta cttcctgtgg tcgcagctgt gccggctgct gcactggacg       120
     gtcggccacg ccatcggctg gtcgtgtgtc atcgccgtga tcatctccgc cggcatcgat       180
     gcctggaagc tgttctacat gggcatcgtg cgcctggagt cgcccctgta tgcgcgcctg       240
     ttcctcgcca ccatccacga tccgaacgaa ctcggcagcc gcgtggtgct ggaaatcgcc       300
     ggtgcgcttg ccggtgttgc cctcggctgg gtgatgttca gttcgcggtc atcggcgcag       360
     aacgtcgact ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page