(data stored in ACNUC7421 zone)

EMBL: CP001111.PE347

CP001111.PE347       Location/Qualifiers
FT   CDS_pept        415274..416026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0347"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xcc:XCC3796 hydrolase, haloacid
FT                   delahogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50052"
FT                   /db_xref="GOA:B4SHK9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK9"
FT                   /protein_id="ACF50052.1"
FT                   /translation="MNTPTPAPSRAIGLVGFDGDDTLWKSEDYYRKAEQDYLDLLSRYV
FT                   DVHDTQTARHLLEVQQRHLGTFGYGVKSMTLSMIEAAIDITGQRIEAKDIQRILEIGHD
FT                   TLRHPVELIDGVREAVAAIAEDYPVVLITKGDLFHQEAKIKVANLAELFPRIEIVSEKD
FT                   PETYARVLAEFDLPMQRFVMVGNSLRSDIEPVVTLGGWGVHTPYAVTWAHETQHGVADD
FT                   EPRMVTADTAHDWPAALAAIEAKASAAA"
     atgaataccc ccacgcctgc gccgtcgcgc gccatcggcc tggtcggttt tgacggtgac        60
     gatacgctgt ggaagagcga ggactactac cgcaaggccg agcaggatta tcttgacctg       120
     ctgtcgcgct atgtcgacgt gcatgacacc cagaccgcgc gtcacctgct ggaagtgcag       180
     cagcgccatc tgggtacctt cggctacggc gtgaagagca tgacgctgtc gatgatcgaa       240
     gcggccatcg acatcaccgg ccagcgcatc gaggccaagg acatccagcg catcctggag       300
     atcggccacg acaccctgcg ccacccggtc gagctgatcg acggcgtgcg tgaagcagtg       360
     gctgcgatcg ccgaagatta tccggtggtg ctgatcacca agggcgacct gttccaccag       420
     gaagccaaga tcaaggtcgc caatctcgcc gagctgttcc cgcgcatcga gatcgtttcg       480
     gagaaggacc cggaaaccta cgcccgcgtg ctggccgaat tcgacctgcc gatgcagcgc       540
     ttcgtgatgg tcggcaactc gctgcgttcg gacatcgagc cggtggtgac cctgggcggc       600
     tggggcgtgc ataccccgta cgcagtgacc tgggcccacg agacccagca cggcgtggcc       660
     gacgacgaac cgcgcatggt caccgccgac accgcccacg attggccggc cgcactggcg       720
     gcgatcgagg ccaaggcctc ggcggcggcc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page