(data stored in ACNUC7421 zone)

EMBL: CP001111.PE348

CP001111.PE348       Location/Qualifiers
FT   CDS_pept        416058..416546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0348"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV3969 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50053"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL0"
FT                   /protein_id="ACF50053.1"
FT                   /translation="MNVRLRALLLSLLLAPATVLAQQTAERSAAYEVETGDRWVDAQLQ
FT                   DINHYAERYPDAFLDEVSRYAGVPRGYISALFTTHGWQAGDIYFACFWAKASGQTCRDS
FT                   VRAFSQDPEGGWETVVKRMPTKPDNLHYRAVRHAIVASYQHWDRPITLDATLKRQLKR"
     atgaacgtcc gactgcgcgc actgttgttg tccctgctgc tggcgccggc caccgtgctg        60
     gcccagcaga ccgccgagcg ttcggccgcc tacgaggtgg aaaccggtga ccgctgggtc       120
     gatgcccagc tgcaggacat caatcactac gccgaacgct acccggacgc cttcctcgat       180
     gaagtgtcgc gctatgccgg cgtgccgcgc ggctacatca gcgcgctgtt caccacccat       240
     ggctggcagg ccggggacat ctacttcgcc tgcttctggg ccaaggccag cggccagacc       300
     tgccgcgaca gcgtgcgcgc cttcagccag gacccggagg gcggctggga gacggtggtg       360
     aagcgcatgc cgaccaagcc ggacaacctg cattaccgcg ccgtgcgcca tgccatcgtg       420
     gccagctacc agcactggga ccggccgatc accctggatg ccaccctgaa gcgccagctg       480
     aagcggtag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page