(data stored in ACNUC7421 zone)

EMBL: CP001111.PE349

CP001111.PE349       Location/Qualifiers
FT   CDS_pept        416709..418073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0349"
FT                   /product="protein of unknown function DUF1338"
FT                   /note="PFAM: protein of unknown function DUF1338; KEGG:
FT                   xcc:XCC3793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50054"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL1"
FT                   /protein_id="ACF50054.1"
FT                   /translation="MSASFVSPDVIRRLFAQAMSRMYRTEVPLYGTLVELVERINAQVL
FT                   DQDPALAAQLQRNDERARLDEERHGAIRVGTVQELATLRRLFAVMGMYPVGYYDLSVAG
FT                   VPVHSTAFRPLTGAALAQNPFRVFTSLLRLELIEDETLRAESAKILARRRIFTDGALAL
FT                   IDQAERDGGLSQADAERFVDEALETFRWHGDATVDLPTYHALHNAHRLVADVVSFRGPH
FT                   INHLTPRTLDIDAAQAAMIEYGMAAKAVIEGPPRRACPILLRQTSFKALEEAVQFPDSE
FT                   GGDAGTHTARFGEIEQRGLALTPKGRALYDQLLSQARDAGGEGSTGGDYGQRLQAVFAS
FT                   FPDDHDTLRQEGLGYYRYQLTDAGRAAPERVADLPAEVLVAAGLATADPIVYEDFLPVS
FT                   AAGIFQSNLGGEEQRAYAAHANREAFEQALGVAVHDEFEIYERLQAESLAALRTA"
     atgagcgcct ctttcgtttc gcctgatgtg atccgccgcc tgttcgcgca ggccatgtcc        60
     cgcatgtacc gcaccgaagt gccgctgtac ggcacgctgg tggaactggt ggagcggatc       120
     aacgcgcagg tgcttgacca ggaccctgcg ctggccgcgc agctgcagcg caacgacgag       180
     cgcgcgcgcc tggatgaaga gcgccacggc gcgatccggg tcggcaccgt gcaggaactg       240
     gccacgctgc gccgcctgtt cgcggtgatg ggcatgtacc cggtgggcta ctacgacctg       300
     tcggtggccg gcgtgccggt gcactccacc gcgttccgcc cgctcaccgg tgccgcgctg       360
     gcgcagaacc cgttccgcgt gttcacctcg ctgctgcgcc tggagctgat cgaagacgaa       420
     accctgcgtg ccgagtcggc aaagatcctg gcacgtcgcc gcatcttcac cgacggcgcg       480
     ctggcgctga tcgaccaggc cgagcgtgac ggcgggctgt cgcaggccga cgccgagcgc       540
     tttgtcgatg aagccttgga aaccttccgt tggcacggcg atgccaccgt cgatctgccg       600
     acctaccacg cgctgcacaa cgcgcaccgg ctggtggccg acgtggtcag cttccgcggc       660
     ccgcacatca accacctgac cccgcgcacg ctggacatcg atgccgcgca ggccgcgatg       720
     atcgaatacg gcatggccgc caaggcggtg atcgaaggcc cgccgcgccg cgcctgcccg       780
     atcctgctgc ggcagaccag tttcaaggca ctggaagaag ccgtgcagtt cccggacagc       840
     gaaggtggcg atgccggtac ccataccgcg cgcttcggcg agatcgaaca gcgtggcctt       900
     gcgctgaccc cgaagggccg cgcgctgtac gaccagctgc tgtcgcaggc acgcgatgcc       960
     ggtggcgaag gcagcactgg tggcgactac ggccagcgcc tgcaggcggt gttcgccagc      1020
     ttcccggatg accatgacac gctgcgccag gaaggcctgg gctattaccg ctaccagctg      1080
     accgacgctg gccgcgctgc gccggaacgc gtggctgatc tgccagctga agtgctggtg      1140
     gccgcgggcc tggccaccgc cgacccgatc gtctacgagg atttcctgcc ggtcagtgcc      1200
     gcaggcatct tccagtcgaa cctgggcggt gaagaacagc gcgcctatgc cgcacatgcc      1260
     aaccgcgaag ccttcgagca ggcgctgggc gtggcggtgc atgacgagtt cgagatctac      1320
     gagcggctgc aggccgaatc gctggcggcg ctgcgcaccg cgtga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page