(data stored in ACNUC7421 zone)

EMBL: CP001111.PE353

CP001111.PE353       Location/Qualifiers
FT   CDS_pept        complement(423830..424345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50058"
FT                   /db_xref="GOA:B4SHL5"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL5"
FT                   /protein_id="ACF50058.1"
FT                   /translation="MFRCLRVPATALLLSALVVPTVHAGAAPQLNSGQTSVLVTSLIVL
FT                   SIPLATSMGLAELSKAPFKASERNGKVAARTPAVPLPPMEVKQVATTPAGDRQVHLQVP
FT                   GKADQTATLQWPAAAGDDPIAGFVVGQQVRFDPTDAGAGWTVKSAQGQALAYVPTAYAA
FT                   GDVMSETL"
     atgttccgtt gcctgcgcgt tcccgccact gccctgctgc tttcggcgct ggtggtgccc        60
     accgtccatg ccggcgccgc gccgcagttg aacagcggcc agaccagcgt gttggtcacg       120
     tcgctgatcg tgctgtcgat tccgttggcc acgtcgatgg gactggccga actgtccaag       180
     gccccgttca aggccagcga gcgcaacggc aaggtcgccg cacgcacgcc ggcggtgccg       240
     ctgccaccga tggaagtgaa gcaggtcgcc accacgccag ccggtgatcg ccaggtgcac       300
     ctgcaggtgc ccggcaaggc cgaccagacc gcaacgctgc aatggccggc ggctgcaggc       360
     gatgacccga ttgccggttt cgtcgtcggc cagcaggtgc gcttcgaccc gaccgacgcg       420
     ggtgccggct ggaccgtgaa gagcgcgcag ggccaggcgc tggcctatgt accgaccgcc       480
     tatgccgccg gcgatgtgat gagcgaaacg ctgtaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page