(data stored in ACNUC7421 zone)

EMBL: CP001111.PE354

CP001111.PE354       Location/Qualifiers
FT   CDS_pept        complement(424378..424881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL6"
FT                   /protein_id="ACF50059.1"
FT                   /translation="MRTLPAVLMPMLIVASLAWSTAAHAERRIVIIHDPGPQGPSLEMS
FT                   TQMVTSARAAAAKEAQDAADAGRPLARPQQIKLPQMQVSAIATTVDGRREVLLRDANDP
FT                   QNTASMQYPRGIGDPAVQFTVGQTVNFEPTGADQGWQLKDNQGRPLEYLPEATGPRDIF
FT                   DTRH"
     atgcgtaccc tgcccgccgt cctgatgccg atgctgatcg tcgcaagcct ggcctggtcc        60
     acggccgctc atgcagagcg ccgcatcgtg atcatccacg acccgggccc gcagggaccg       120
     agcctggaga tgtccacaca gatggtgacg tcggcccgcg cggcggcggc gaaggaagcc       180
     caggatgccg ccgacgctgg ccggccgctg gcccgcccgc agcagatcaa gctgccgcag       240
     atgcaggtga gtgcgatcgc caccaccgtg gatggccgcc gcgaagtgct gctgcgcgat       300
     gccaacgatc cgcagaacac cgcatcgatg cagtacccgc gcggcatcgg cgatcccgcc       360
     gtgcagttca ccgtgggcca gaccgtgaac ttcgaaccga ccggcgccga ccagggctgg       420
     cagttgaagg acaaccaggg ccgtccactg gaatatctgc ccgaggccac cggcccgcgc       480
     gacatcttcg atacccggca ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page