(data stored in ACNUC7421 zone)

EMBL: CP001111.PE357

CP001111.PE357       Location/Qualifiers
FT   CDS_pept        complement(426228..427193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0357"
FT                   /product="protein of unknown function DUF1022"
FT                   /note="PFAM: protein of unknown function DUF1022; KEGG:
FT                   xcv:XCV0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50062"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL9"
FT                   /protein_id="ACF50062.1"
FT                   /translation="MPQVKRSSAPWTVTDGRAGNVRQAVALASALRQGTHRPLVLQPRA
FT                   PWRWLSPRRLPGDVNGYGEAFASLAAEPPALAIGCGRQAAGALRVLRARGSQVVQILDP
FT                   RISARHWDMVVVPEHDALRGSNVLTLLGSLNPVDDDWLAWGRAAFASFSTLPGPRTALL
FT                   VGGPTPLAPWDETAMVGVFQALADQIRAEGGSLLATTSRRTPPALAEILRATFADLPHV
FT                   IWGDGGDGTNPYGGLLGWANRVVVSPDSVNLLSEACATRMPVMVALADTAQGRLARFQQ
FT                   QLRERGRLQAHWLDWQYDRIEPLRETARVAAEVKLRLALR"
     atgccacagg tgaaacgatc gagtgcgccc tggacggtca cggacggccg tgcgggcaat        60
     gtccgccagg cggtcgcgct ggcctctgcg ctgcgccagg gcacccatcg gccgctggtc       120
     ctgcagcccc gtgcgccctg gcgctggctc tcgccgcggc gcctgccggg cgatgtgaac       180
     ggctacggcg aggcgttcgc gtcgctggcc gcggagcctc ccgccctggc gatcggctgt       240
     ggccgtcagg ccgccggcgc cctgcgcgtg ctgcgtgcac gtggcagcca ggtggtgcag       300
     atcctcgacc cgcgcatcag cgcccgccac tgggacatgg tggtggtgcc cgaacacgat       360
     gccctgcgtg gcagcaatgt gctgaccctg ctcggcagcc tcaatccggt ggacgacgac       420
     tggctggcct ggggccgtgc cgcgttcgcc agcttcagca ccctgcccgg cccgcgcacc       480
     gcgttgctgg tgggtggacc gacaccgctg gctccgtggg atgagacggc gatggtgggc       540
     gtgttccagg cgttggccga tcagattcgc gctgagggcg gcagcctgct ggcgaccacc       600
     tcgcgacgca cgccgccggc cttggccgag atcctgcgcg cgacgttcgc cgatctgccg       660
     catgtgatct ggggcgatgg cggcgacgga accaatccct atggcggcct gctcggctgg       720
     gccaaccgcg tggtggtctc gcccgattcg gtgaacctgc tttctgaagc ctgcgccacg       780
     cgcatgccgg tgatggtggc gctggccgat accgcgcagg ggcggctggc acgctttcag       840
     cagcagctgc gcgagcgcgg gcggctgcag gcgcactggc tggactggca gtacgaccgc       900
     atcgaaccgc tgcgcgagac cgcgcgggtg gcggcggagg tgaagctgcg tttggcattg       960
     aggtag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page