(data stored in ACNUC7421 zone)

EMBL: CP001111.PE360

CP001111.PE360       Location/Qualifiers
FT   CDS_pept        complement(429204..429605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50065"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM2"
FT                   /protein_id="ACF50065.1"
FT                   /translation="MAKLTLASVDALRTRFADDAACDTALAAFADPAALRAPLRELVEA
FT                   QHRYLQAEFEVAQVADVLRRDQKYAPVGRPSINIVQLRKQQAATKQAALIARQVVAQAA
FT                   QTFARASGMTVKAKQSPSEACVAWLGALR"
     atggccaaac tgaccctggc cagcgtggat gcgctgcgta cccgctttgc cgatgacgcc        60
     gcctgcgata ccgcactggc cgccttcgcc gacccggccg cgctgcgcgc gccgctacgt       120
     gagctggtgg aggcacaaca ccgctacctg caggccgaat tcgaagtggc gcaggtggcc       180
     gacgtgctgc gacgtgacca gaaatatgcc ccggtgggtc ggccgtcgat caacatcgtg       240
     cagctgcgca agcagcaggc cgcgaccaag caggcggcgc tgatcgcacg ccaggtggtg       300
     gcgcaggccg cgcagacctt cgcgcgcgcg agcgggatga cggtgaaggc caagcagagc       360
     ccgagcgaag cgtgcgtggc atggttgggc gcgttgcgct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page