(data stored in ACNUC7421 zone)

EMBL: CP001111.PE364

CP001111.PE364       Location/Qualifiers
FT   CDS_pept        complement(432610..433170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0364"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: xcb:XC_0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50069"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM6"
FT                   /protein_id="ACF50069.1"
FT                   /translation="MSRTASPRARSTNPEVPRRNGQPRVLSRGDLRLLVLALIGEQPRH
FT                   GYELMQLISNQFMQAYTPSAGTMYPLLASFEQAGWIEAEEVDGKRIFRITAAGEFELKV
FT                   QRTQVRLAQRRAFDRAREITKASLPPPLAGALREFKRALVHHHGRWAEGEAEEVAALLT
FT                   RASALLNGAAGSESQAFSTTQPD"
     atgagccgta ccgcttctcc cagagcccgt tccaccaatc cggaagtacc acgccgcaac        60
     ggccagccgc gggtgctcag ccgcggcgac ctgcgcctgc tggtgctggc cctgatcggc       120
     gagcagccgc gccacggcta cgagctgatg cagctgatca gcaaccagtt catgcaggcc       180
     tacacgccca gcgccggcac catgtacccg ctgctggcca gcttcgagca ggccggctgg       240
     atcgaggccg aggaagtgga cggcaagcgg atcttccgca tcaccgccgc cggcgagttc       300
     gagctgaagg tgcagcgcac ccaggtgcgc ctggcgcagc gacgtgcctt tgaccgtgcc       360
     cgcgagatca ccaaggcctc gctgccgccg ccgctggccg gcgccctgcg cgagttcaag       420
     cgggcgctgg tgcatcacca cggccgctgg gccgagggcg aggcagaaga agtagcggcg       480
     ctgctgacgc gggcgtccgc gctgctcaac ggtgcggccg gtagcgagag ccaagccttt       540
     tcaacgaccc agccagactg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page