(data stored in ACNUC7421 zone)

EMBL: CP001111.PE365

CP001111.PE365       Location/Qualifiers
FT   CDS_pept        433739..436426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0365"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: xcv:XCV0611 pyruvate dehydrogenase
FT                   subunit E1"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50070"
FT                   /db_xref="GOA:B4SHM7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM7"
FT                   /protein_id="ACF50070.1"
FT                   /translation="MNWLNEVLNNDPNPVETQEWIESLKAVIDVEGSERAHQLLEGMVE
FT                   LTRRSGAYLPFSPTTEYVNTIEPQLEAKSPGNAELEWRIRSIIRWNAMATVVRANRKPG
FT                   DLGGHIASFASGATLYDVGFNHFWRAPSENHPGDLLFIQGHSAPGIYARSFLEGRISEE
FT                   QLDKFRMEVDGGGLSSYPHPWLMPEYWQTPTVSMGLGPLAAIYQAQFMRYLENRGLIEK
FT                   SDRKVWCFIGDGESDEPETLGAIALAGREGLDNLIFVVNCNLQRLDGPVRGNGKIIQEL
FT                   EGVFRGGGWNVIKLLWGGYWDALLAKDSDGVLKKLMMETVDGEYQNCKAFGGAYTREHF
FT                   FGKYPETAAMVAGLSDDDIWRLNRGGHDPHKVYAAYHQAVNTKGMPTVILAKTVKGYGM
FT                   GSAGEALNPTHQTKKLDDEAVRHFRDRFNIPVTDAQLADGQVPFYHPGPDSPEVQYLQE
FT                   RRAALGGYLPQRRRKADKTFVAPKLEAYERLLKSSGERSYSTTMAFVQSLNITLRDKEL
FT                   GPHIVPIVADEARTFGMEGLFRQIGIYAPFGQKYKPVDADQLMFYREDQSGQVLQQGIS
FT                   EPGAISSWMAAGTSYSVSNVPMLPFYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAG
FT                   RTTLNGEGLQHEDGFSHLVAGGIPNVRSYDPTFGFEVTVVLQHGTKRMMEDQVDEYYYV
FT                   TLMNENYTHPEMPEGAAEGIVKGMYLLTDAGKPKKGELRVQLLGSGTILREAIAAAELL
FT                   DKDFGVTADIWSCPSFNELRRDGFDVERANRLHPEGEQRKAYVTELLEGRQGPAIAATD
FT                   YVRAYADQIRAFVPMSYTVLGTDGFGRSDTRANLRRFFEVDRYYIAHAAIAALAKEGKM
FT                   TAKDVARAIKQYKIDPEKANPVGV"
     atgaactggt tgaacgaggt gctgaacaac gacccgaatc ctgtggaaac ccaggagtgg        60
     atcgagtcgt tgaaggccgt tattgatgtc gagggctccg agcgcgcgca tcagctgctg       120
     gaaggcatgg tggaactgac ccgtcgttcg ggcgcctacc tgccgttctc tcccaccacc       180
     gaatacgtca acaccatcga gccgcagctc gaggccaaga gcccgggcaa tgccgagttg       240
     gaatggcgca tccgttcgat catccgctgg aacgcgatgg ccaccgtggt ccgcgccaac       300
     cgcaagccgg gtgacctggg cggccacatc gcctcgttcg cctccggcgc caccctgtac       360
     gacgtgggct tcaaccactt ctggcgcgcc ccgagcgaaa accacccggg cgacctgctg       420
     ttcatccagg gccacagcgc cccgggcatc tacgcgcgtt ccttcctgga aggccgcatc       480
     agcgaagagc agctggacaa gttccgcatg gaagtggacg gcggtggcct gtcctcgtac       540
     ccgcacccgt ggctgatgcc ggaatactgg cagaccccga ccgtgtcgat gggcctgggc       600
     ccgctggccg ccatctacca ggcgcagttc atgcgctacc tggaaaaccg tggcctgatc       660
     gagaagtccg accgcaaggt gtggtgcttc attggcgacg gcgagagcga cgagccggaa       720
     accctgggtg ccatcgccct ggccggccgt gaaggcctgg acaacctgat cttcgtggtg       780
     aactgcaacc tgcagcgcct ggacggcccg gtacgcggca acggcaagat catccaggaa       840
     ctggaaggcg tgttccgtgg cggcggctgg aacgtgatca agctgctgtg gggcggttac       900
     tgggatgccc tgctggccaa ggacagcgac ggcgtcctga agaagctgat gatggaaacc       960
     gtcgacggcg aataccagaa ctgcaaggcc ttcggcggcg cgtatacccg cgagcatttc      1020
     ttcggcaagt acccggaaac cgctgcgatg gttgccggcc tgagcgacga cgacatctgg      1080
     cgcctgaacc gtggtggcca cgacccgcac aaggtgtacg ccgcctacca ccaggccgtg      1140
     aacaccaagg gcatgccgac cgtcatcctg gccaagaccg tgaagggtta cggcatgggc      1200
     agcgccggtg aggcactgaa cccgacccac cagaccaaga agctggacga cgaagcggtg      1260
     cgccacttcc gcgaccgctt caacattccg gtgaccgacg cgcagctggc cgacggccag      1320
     gtgccgttct accacccggg cccggattcg ccggaagtgc agtacctgca ggaacgccgt      1380
     gccgcgctgg gcggttacct gccgcagcgc cgccgcaagg ccgacaagac cttcgtggca      1440
     ccgaagctgg aagcctacga gcgcctgctg aagagcagcg gcgagcgcag ctactccacc      1500
     accatggcct tcgtgcagag cctgaacatc accctgcgtg acaaggaact gggcccgcac      1560
     atcgtgccga tcgtggccga cgaagcgcgt accttcggta tggaaggcct gttccgccag      1620
     atcggcatct acgcgccgtt cggccagaag tacaagccgg tggacgccga ccagctgatg      1680
     ttctaccgcg aagaccagag cgggcaggtg ctgcagcagg gcatcagcga gccgggcgcg      1740
     atcagctcgt ggatggcggc cggtaccagc tactcggtca gcaacgtgcc gatgctgccg      1800
     ttctacatct actactcgat gttcggcttc cagcgcgtgg gcgacatcgc ctggcaggcc      1860
     gccgacatgc gtacccgcgg cttcctgctg ggtggcaccg ccggccgcac cacgctgaac      1920
     ggtgaaggcc tgcagcacga agatggcttc agccatctgg tggccggtgg catcccgaac      1980
     gtgcgcagct acgacccgac cttcggcttc gaagtgaccg tggtactgca gcacggcacc      2040
     aagcgcatga tggaagacca ggtggacgag tattactacg tcaccctgat gaacgagaac      2100
     tacacccacc cggaaatgcc ggaaggtgcg gctgaaggca tcgtcaaggg catgtacctg      2160
     ctgaccgacg ccggcaagcc gaagaagggc gagctgcgcg tgcagctgct gggctcgggc      2220
     accatcctgc gcgaagccat tgccgccgcc gagctgctgg acaaggactt cggcgtgacc      2280
     gccgacatct ggagctgccc gagcttcaac gaactgcgtc gcgatggttt cgacgtggaa      2340
     cgtgccaacc gcctgcatcc ggaaggtgag cagcgcaagg cctacgtgac cgagctgctg      2400
     gaaggccgcc agggcccggc gattgccgcc accgactacg tgcgtgcgta tgcggaccag      2460
     atccgtgcgt tcgtgccgat gtcgtacacc gtgctgggta ccgatggctt cggccgttcg      2520
     gatacgcgtg cgaacctgcg tcggttcttc gaggtggatc gctactacat cgcccatgcc      2580
     gcgattgcgg cgctggcgaa ggaagggaag atgaccgcga aggatgtggc ccgggcgatc      2640
     aagcagtaca agattgatcc ggagaaggct aaccctgttg gggtttga                   2688
//

If you have problems or comments...

PBIL Back to PBIL home page