(data stored in ACNUC7421 zone)

EMBL: CP001111.PE366

CP001111.PE366       Location/Qualifiers
FT   CDS_pept        436501..439539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0366"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: shl:Shal_2181 type III
FT                   restriction protein res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50071"
FT                   /db_xref="GOA:B4SHM8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM8"
FT                   /protein_id="ACF50071.1"
FT                   /translation="MLTTGEEFAVAAAMREGQRRAANAVREYLARDYAGKSFLVVMPTG
FT                   AGKSGLIASVCQSHPRGPIVVLSPRAAVCRQLMDEISGKFFSDRGVLVESPRSVKELGG
FT                   EIKEDCIYVGTFQKLIRMKSTAFRRLAESCSLLIVDEGHSEPAPLWGKAVRQFSCHKII
FT                   VTATPYRNDLFQFDIGLETTFCYTFKKAVEHQVILEPAFEQCTIADAAQRTSIFLSENP
FT                   TAKAIVKAKSLGDVKMLKELMGGAGLSTLAIHDKLPDDTSAGTAKTVPSGLNSRDVRVV
FT                   IHQRKLDEGVDLPSAKLCVLTYPVASGQELVQTVGRIVRNFESIQPLVLDCGSSSNTKM
FT                   WANYLEFDSSISSDDGWAKFVNSLDTAKLIESYLDTFPQYMYLGAAFREKFELLSLDVD
FT                   RDIRVPTASVCFLGVEEGFTIESFVDAMLWRNDHAGELAKCYDSAHGFKVIVSIRFESS
FT                   KYLKSKLFFEPSLHVVVAKKIGNYLAVFDSRSINHAGDTALGTKQPVDPQRLFNLSARG
FT                   AFTRVKETHARSISSARRRPERVSHVGPELSASYSGQSAASYALSVTKVDNLDLAQGVE
FT                   SSYYLSTGSGRVSDQKNGSFSLERLSEWVDEVASVLDEDAPSLSPVIGAFALPIDAMAV
FT                   SGPLSMTIDFTDLPAGTKMVSGAKSTPLDAGFLFLECPNWQVKVGSSTLRFAYIEEVER
FT                   IVFTASPDVMLVSPDGEAVSLVQDMNSRSLKILFADGVSYVDGKFYKSALPTTVGIDLE
FT                   STVIGASIYPVPELQLAGLSEKGLFQDREYVGTSAENFDANSVFNLIDSLARGDYQKYR
FT                   STQYDVLRRLVPDIDLVVCTDMGTEAADFIVSSPKSLCFVHVKCGESKRPKSPAGALAE
FT                   VGAQAIKNIEYLVSSNESLPFGNEGRLALPWPHRGAIHKLKHRVRFIAKDGVERTVPST
FT                   PKAYSKCVASAIETIKKRRRSPGCKKEVWIVAANSFSYGSFKKEIKMGAAAKAESLQAY
FT                   QLIDAWLAVCSANDVDLKIMVSP"
     atgctcacca cgggagagga attcgcggta gcagcagcga tgcgagaagg acaacgtcgc        60
     gcggccaatg cggttcgaga atatcttgca agggactacg caggtaagtc attcctggtc       120
     gtaatgccta ccggcgcagg aaaatcagga ctgattgcct ccgtctgcca gtctcaccct       180
     cgcggcccaa tcgttgtact cagtcctcga gcggcagtct gccggcagct tatggacgaa       240
     atatcaggga agttcttctc ggacaggggc gtgctcgtag agtcgcctcg ctcagtcaaa       300
     gagttgggcg gagagattaa ggaggactgc atctatgtcg gtactttcca aaagctgatc       360
     cgcatgaagt cgacggcgtt ccgccgtcta gccgagagct gctcgctgct tattgtcgat       420
     gaaggccatt cggagcccgc tccgctctgg ggtaaggctg ttcggcagtt cagctgtcac       480
     aagataatag tgacggcgac cccgtaccgt aatgatctgt tccaattcga catcggcctt       540
     gaaacgacat tttgctacac cttcaagaag gcggtcgagc atcaagtcat tttggagccg       600
     gcattcgagc agtgcacaat tgcggacgcc gcccaacgta catcgatctt cctctcagaa       660
     aacccaaccg caaaggcaat cgtaaaggcc aagagtcttg gggatgtcaa gatgctgaag       720
     gaattgatgg gcggcgcggg actaagtacg ctggcaatcc acgataagtt gccggacgat       780
     acctcggcag gaaccgccaa gactgtccct tctggactaa actcgcgaga cgttcgagta       840
     gtgattcacc aaagaaagct ggatgagggc gtggaccttc catctgcaaa gttgtgtgtc       900
     ctcacctatc cagtagcaag cggtcaagag ctcgtgcaga ccgttggaag aatcgtgcgg       960
     aacttcgaga gcatacagcc actggtgctt gattgtggct cgtccagcaa cacaaagatg      1020
     tgggctaact acctcgagtt tgactcatcc atctcctcag atgatggatg ggccaagttc      1080
     gtcaattctc ttgacacggc aaagctgatc gagagctacc tcgacacctt cccccagtac      1140
     atgtacctgg gagcggcatt ccgggaaaag ttcgaactgt tgagcctcga tgtggataga      1200
     gatattcgag tgccgaccgc gtctgtatgc ttcctggggg tggaggaggg cttcacaatc      1260
     gagtcctttg ttgacgccat gctttggaga aatgatcacg ctggggaact ggcgaaatgc      1320
     tatgactcgg cgcacggatt caaggtgatc gtgtctatcc ggtttgagag ttccaagtat      1380
     ctgaagagta agttgttctt cgagccgtct cttcatgtgg tagttgcaaa aaagattggc      1440
     aactacttgg cagtattcga cagtcgctca atcaatcatg cgggggacac ggcgctgggt      1500
     acaaagcagc ccgtcgatcc acagcgacta ttcaatctct cagcaagggg tgctttcact      1560
     agagtaaaag agacgcacgc gcgatcgata agctcggcta gaagaaggcc ggagcgagtt      1620
     tcgcatgtag gaccagagct aagtgcctcg tactcagggc agtcggcagc tagctatgct      1680
     ctttcagtaa cgaaggtcga caatctcgat ttggcccaag gtgtagagag cagctactac      1740
     ctcagtaccg gatcgggaag agtctctgac caaaaaaatg gctcattcag cctggagcgg      1800
     ctgtcggagt gggtagacga ggtggcgtcc gttttggatg aggatgcgcc gtcgctgagt      1860
     ccggtgatcg gggcttttgc tctgccaatc gatgcgatgg cagttagcgg gcccctatct      1920
     atgactatcg acttcacgga tctcccggcg ggtaccaaga tggtctccgg cgcaaaatcc      1980
     acaccgcttg acgcagggtt tctttttcta gagtgcccga attggcaagt caaggtcgga      2040
     tcgtcgacgt tgagatttgc ctacatcgaa gaggtcgaga ggatagtctt cactgctagc      2100
     ccagacgtga tgttggtgtc tcccgatgga gaggccgtat cattggttca agacatgaac      2160
     tcgagatcgc ttaagatctt gttcgccgat ggagtttcat acgtagatgg aaagttctac      2220
     aagtcggctt tgccgactac agtggggatc gatctagaga gcactgttat tggcgcatca      2280
     atctatcctg tccctgagct tcagttggct ggtttgtccg agaaagggtt gtttcaggat      2340
     cgggagtatg tcgggactag cgcggagaac tttgatgcga actcagtgtt caatcttatc      2400
     gacagcttgg ctcgcggcga ctatcaaaaa tatcgatcaa cccaatacga tgtgctcagg      2460
     aggctagttc ccgacatcga tcttgtggtg tgcacagata tgggtacgga ggctgcggat      2520
     ttcatagtgt cgtcaccaaa gtcgctttgc tttgtacatg ttaagtgtgg tgagtcaaag      2580
     cgtcccaagt cgccagctgg tgcccttgcc gaagtggggg ctcaggcgat aaagaacatt      2640
     gagtatctgg tttcgtcgaa tgaatcgctg cccttcggaa atgaggggcg gcttgcattg      2700
     ccttggccgc atagaggtgc gatccacaag ctcaagcatc gggtgcgatt catagcgaag      2760
     gacggcgtgg agcgcacggt tccatcaacg ccaaaggctt actctaaatg cgtagcatca      2820
     gcaattgaaa caataaagaa gcggaggaga tcacctggat gcaagaaaga agtgtggatc      2880
     gtcgccgcaa actccttctc ttacggatcg ttcaagaaag aaattaaaat gggggctgct      2940
     gctaaggcgg aatcactaca ggcatatcaa ctaatagatg catggctggc agtgtgcagc      3000
     gcaaacgatg ttgatcttaa gatcatggtc tccccgtag                             3039
//

If you have problems or comments...

PBIL Back to PBIL home page