(data stored in ACNUC7421 zone)

EMBL: CP001111.PE37

CP001111.PE37        Location/Qualifiers
FT   CDS_pept        42905..45178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0037"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC1143 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49742"
FT                   /db_xref="GOA:B4SR41"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR41"
FT                   /protein_id="ACF49742.1"
FT                   /translation="MSPTRTSRGRLPVARPLVAALSALLPLVAAAQETPAAKDPVALDA
FT                   LQVTAQRRVENAKDVPVAISAIQGEKLDVLGSAGDDIRFLAARVPSLNIESSYGRAFPR
FT                   FYIRGLGNTDFDLNASQPVSLVYDDVVQESPLLKGFPLFDLANVEVLRGPQGTLFGRNT
FT                   PAGVVKFDSARPSQDADGYVRVGYGSYNSWNVQGAYGGPLTDRWSARVSAIYQRRDDWV
FT                   DNTRAGAPNSGFEGYDEAAGRVQFLYEGDDFEALFNLHKRKLNGTARLFRANIIEKGGN
FT                   SLVENFDRDKVANDGVNFSDLKTWGGSARLQWNLGSVTLHSITGYETAESLNRGDIDGG
FT                   YGDASLGAGNYGPGFIPFSSESADGLPHHRQWTQEFRVESNEWGRFDWQAGVFYFDEDV
FT                   TINNFNYNSLKPGNPQTGHVVQNQRNKAWAVFASGDFDVTDRFKLRAGVRYTQDKKDFN
FT                   ASVLQAVLPFGTPVSGPYLANTDVNDVSWDVSGVYKLTDNVNAYARVAKGFRAPSIQGR
FT                   LAFAPGLSQADSEKVISYEAGIKADLFERRARLGLSVFRYNVDGQQLIAVGGTNNTATL
FT                   LNADKTIGQGVELDLEAYLADNVLLTFGSSYNDTEIKDKDLAVAICGGGCTINDPTTVI
FT                   NGGTYALVNGNPLPQAPKWIHNATLRVGFPLSDGSELYAYTDWAYRSAVNFFIYESPEF
FT                   RGRSSLEGGLRLGYNWDYGQYDVAVFGRNLTNQTRVVGAIDFNNLTGFLNEPRTWGVEF
FT                   TAKF"
     atgtctccga cccgcacttc ccgtggccgc cttccggtcg cgcgccccct cgttgccgct        60
     ctttccgccc tgttgccgct ggtagcagcc gcccaggaaa ctcccgccgc caaggatccg       120
     gttgccctcg acgccctgca ggtgaccgcg cagcgccgtg tcgagaacgc caaggacgtg       180
     ccggttgcga tcagcgcgat ccagggcgag aagctcgatg tgctgggttc ggcgggcgac       240
     gacatccgct tcctggccgc gcgcgtgccc agcctcaaca tcgagtcgtc ctacggccgt       300
     gccttcccgc gcttctacat ccgtggcctt ggcaacaccg atttcgacct caatgcgtcg       360
     cagccggtgt cgctggtgta cgacgacgtg gtgcaggaaa gcccgctgct gaagggcttc       420
     ccgctgttcg acctggccaa tgtggaagtg ctgcgcggcc cgcagggcac gctgttcggc       480
     cgcaacactc cggccggcgt ggtcaagttc gattcggcgc gcccgtcgca ggatgccgac       540
     ggctacgtgc gcgtgggcta tggcagctac aacagctgga acgttcaggg cgcctacggc       600
     ggcccattga ccgatcgctg gtcggcgcgc gtgtcggcca tctaccagcg ccgtgacgac       660
     tgggtcgaca acacccgtgc cggcgcgccc aacagcggtt tcgaaggcta tgacgaagcc       720
     gccggccgcg tgcagttcct gtacgaaggc gacgacttcg aagcgctgtt caacctgcac       780
     aagcgcaagc tcaacggcac cgctcgcctg ttccgcgcca acatcatcga aaagggtggc       840
     aattcgctgg tcgagaactt cgaccgcgac aaggtcgcca acgacggcgt caacttctcc       900
     gacctgaaga cctggggcgg cagcgcacgc ctgcagtgga acctcggttc ggtgaccctg       960
     cattcgatca ccggttatga aaccgccgaa tcgctcaatc gtggtgacat cgacggtggc      1020
     tacggcgacg catcgctggg cgctggcaac tatgggccgg gcttcatccc gttctcatcg      1080
     gagtcggccg acggcctgcc gcaccatcgc cagtggaccc aggagttccg cgtcgaatcc      1140
     aacgaatggg gccgcttcga ctggcaggcc ggcgtcttct atttcgacga agacgtgacc      1200
     atcaacaact tcaactacaa ctcgctgaag ccgggcaacc cgcagaccgg ccacgtggtg      1260
     cagaaccagc gcaacaaggc ctgggcggtg tttgcctcgg gtgacttcga tgtcaccgac      1320
     cgtttcaagc tgcgtgccgg cgtgcgctac acccaggaca agaaggactt caacgccagc      1380
     gtgctgcagg ccgtccttcc gttcggcacc ccggtcagtg gcccgtacct ggccaacacc      1440
     gacgtcaacg acgtcagctg ggatgtcagc ggcgtgtaca agctgaccga caacgtgaat      1500
     gcctacgccc gcgtggccaa gggcttccgc gcgccgtcga tccagggccg cctggccttc      1560
     gcgccgggcc tgtcgcaggc cgattcggag aaggtgatct cgtatgaggc cggcatcaag      1620
     gccgacctgt tcgagcgccg cgcgcgcctg ggcctgagcg tcttccgcta caacgttgac      1680
     ggccagcagt tgatcgccgt gggcggcacc aacaacaccg ccaccctgct caacgccgac      1740
     aagaccatcg gccagggcgt ggagctggac ctggaagcct atctggccga caacgtgctg      1800
     ctgaccttcg gcagcagcta caacgacacc gagatcaagg acaaggatct ggcggtagcg      1860
     atctgcggcg gtggctgcac catcaacgac ccgaccaccg tcatcaacgg tggcacctac      1920
     gcactggtca acggcaaccc gctgccgcag gcgccgaagt ggatccacaa cgcgaccctg      1980
     cgcgtcggct tcccgctcag cgatggcagc gagctgtatg cctacaccga ttgggcctac      2040
     cgcagcgcgg tgaacttctt catctacgag tcgccggaat tccgcggccg tagttcgctg      2100
     gaaggcggcc tgcgcctggg ctacaactgg gattacggtc agtacgatgt ggcggtgttc      2160
     ggccgcaacc tgaccaacca gacccgcgtg gtcggcgcga tcgacttcaa caacctgacc      2220
     ggcttcctca acgagccgcg tacctggggc gtggagttca ccgcgaagtt ctga            2274
//

If you have problems or comments...

PBIL Back to PBIL home page