(data stored in ACNUC7421 zone)

EMBL: CP001111.PE370

CP001111.PE370       Location/Qualifiers
FT   CDS_pept        complement(442089..442187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50075"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN2"
FT                   /protein_id="ACF50075.1"
FT                   /translation="MFKIIGATVVYGFALYGLGRWLTDQQLVGADD"
     atgttcaaga ttatcggtgc cacggtggtt tacggtttcg cgctgtatgg gctgggccgc        60
     tggctgacgg accagcagct tgtcggcgca gatgactga                               99
//

If you have problems or comments...

PBIL Back to PBIL home page