(data stored in ACNUC7421 zone)

EMBL: CP001111.PE371

CP001111.PE371       Location/Qualifiers
FT   CDS_pept        442710..443714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0371"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: hha:Hhal_1283 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50076"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN3"
FT                   /protein_id="ACF50076.1"
FT                   /translation="MDTDNRSSLARQWRLLQLLQPAPHYRTVKELAQTLAAESYKGGTR
FT                   TIERDLNALSLQFPIESNDLQKPYGWAWMRGAAAFSMPGMSVSQAVVLLTAQRNLQGLL
FT                   PANHWPALTPFFDQAEKTLAAVRTTRSTRRWHEKVAVVPASQSLLPAAVDTDVAVNVHQ
FT                   ALFNEKQLRLYYVARGRSDASEYVFHPYGMIQRGTSSYLAGRIDGRTETTTLSLHRVQR
FT                   AEMLDADTEGAESFELGNYASRVAAGFESKGPLSVELELDEALAQHLAETPLSRDQKLD
FT                   VGDGLVPRLRATVDDSAQLRWWLLGLGASVRVLAPAALADDIAARHRSAAQRY"
     atggacaccg ataaccgctc ctcgctggcg cgccagtggc gtctgctgca gttgctgcag        60
     cctgctccgc actaccgcac cgtgaaggag ctcgcccaga ccttggcggc ggagagctac       120
     aagggaggga ctcgaaccat cgaacgggat ctgaacgccc tgtcgctgca gttccccatc       180
     gagagcaatg atcttcagaa accctatggt tgggcatgga tgcgcggcgc ggccgccttc       240
     agcatgccgg gcatgtccgt ttcacaggcg gtggtgctgc tcaccgcgca gcgcaacctg       300
     cagggactgt tgccagccaa tcactggcct gcactgacgc cgttctttga ccaggcagag       360
     aagacgctgg cggcggtccg cacgacgcgt tccacgcggc gctggcacga gaaggtcgcc       420
     gtcgtgccag ccagccagtc cctgctgccg gctgcggtgg acaccgacgt ggcggtcaac       480
     gtgcatcagg cgcttttcaa cgagaagcag ctgcgcttgt actacgtggc ccgtggccgt       540
     agcgatgcca gtgagtacgt cttccatccc tacgggatga tccagcgtgg aacgtccagt       600
     tacctggctg gacggattga tgggcgcacg gagaccacta cgctgtcgct gcaccgggta       660
     cagcgtgcag aaatgctcga cgccgacacc gaaggtgctg agtccttcga actcggaaac       720
     tatgcgagcc gggttgccgc aggcttcgag agcaagggac ctctgtccgt tgagctggag       780
     cttgatgaag ccctggccca gcacctggcg gagacaccgc tctcccgtga tcagaagctg       840
     gacgtcgggg acggtcttgt tccccgtctg cgggccaccg tcgatgactc cgcccaactg       900
     cgctggtggc tgctcggcct gggcgcatcg gtacgcgttc tggctcccgc agcactggcc       960
     gatgatatcg ccgctcgcca ccgaagcgcc gcacagcgtt actga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page