(data stored in ACNUC7421 zone)

EMBL: CP001111.PE372

CP001111.PE372       Location/Qualifiers
FT   CDS_pept        443803..445566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50077"
FT                   /db_xref="GOA:B4SHN4"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN4"
FT                   /protein_id="ACF50077.1"
FT                   /translation="MFAVKNQCLGLLDRITTLADSAAIELPENHSLAEEMQRAELLVPI
FT                   IGAFSAGKSSLINTFLGADILPVGITPETELATELRFSRDPHVLAHRADGGSDRLAVED
FT                   LLSIKPRASSYTHLELHLDDPRLEALYPQVLVDMPGFGSSLDSHNKAIAHYLPRGAHFI
FT                   VAVSVPDGTLAESTLRQLETMHTYEAGFSILLSKANLRSAEEVDAVEVAVREQLELRLG
FT                   VAPAMARDDRKQGNGLASLLPKISASDLWIGRFLPRISSQLAHARAQVKMARKALDQSD
FT                   ADIDRSVRQLNDALDDLNAQRDALVAKLGRSRLSQVVEQCVEEVGQALREASSELQAAA
FT                   AGGNNPRFAQVVSDISRQRLSRVVKERMEGLSQQAIGDLAKSLSQREVDEVGSVGGPDW
FT                   TQQMQTRVQETLTQTGQALERWQGNLQKAREDEKLLRPYAGDDENDREKTQRARVAFRS
FT                   ITTVLAVTTSVVAPAIELVVIFLPEILGFVSRKLREEELRKTIDNQVIPSVQREFRTKL
FT                   PELLQAQVDGLIEQAVHEFKTAIEEKRQLLESVVAEQSSPARAARVKALDAAEAGLTSV
FT                   ANEVVALESAR"
     atgttcgctg ttaagaatca atgccttggt ctgttggacc ggattacgac gctggctgac        60
     agcgcagcga tcgaactgcc tgaaaaccac tcgctcgccg aagaaatgca gcgggccgaa       120
     ctgttggtac cgatcatcgg tgcgttcagt gcaggaaaga gctcgctgat caacaccttc       180
     ctgggcgcgg acatcctccc ggtcggtatc accccggaga ctgagctggc caccgagttg       240
     cgcttcagcc gggatcccca cgttctggcg caccgtgccg atggtggcag tgatcggctc       300
     gccgtggagg acttgctgtc catcaagccg cgggcctcgt cgtacacgca cctggaactg       360
     catctggacg acccgcgcct ggaagcgctg tatccacagg ttctcgtgga catgcccggc       420
     ttcggctcct cgctggacag ccacaacaag gccatcgccc attatctgcc gcgtggcgcg       480
     cacttcatcg tggccgtgag cgtgcccgac ggtactctgg ccgagtcgac gctgcgccag       540
     cttgaaacca tgcataccta tgaggctgga ttctcgatcc tgctgagcaa ggcgaacctg       600
     cgttcagccg aagaagtgga tgccgtggaa gtggctgtac gggagcagct tgagctgcgc       660
     ctgggcgttg cgccggccat ggcacgcgac gaccgcaagc agggcaatgg actggccagt       720
     ctgctgccca agatcagcgc aagtgatctg tggatcggcc gcttcctgcc gcgaatctcg       780
     agccagcttg cccacgctcg tgcccaggtg aaaatggcac gcaaggcttt ggatcagagc       840
     gatgcggata ttgatcgcag cgtacgtcag ctgaatgatg ccctggatga tctgaacgcc       900
     cagcgcgacg ccctcgtggc caagctgggc cgtagccgcc tgagccaggt ggtcgaacag       960
     tgcgttgagg aagtaggcca ggcccttcgc gaggcctcca gtgagctgca ggcggccgct      1020
     gccggtggca acaacccgcg gtttgcgcag gtcgtcagcg atatttcccg ccagcgcttg      1080
     agtcgtgtgg tcaaggaacg catggaaggg ctgagccagc aggcgattgg tgatctggcc      1140
     aaatccctgt ctcagcgcga ggtggatgag gttggcagtg tcggcggacc ggactggacg      1200
     caacagatgc agacgcgcgt gcaggagacg ctgacccaga ccggtcaagc gctcgagcgc      1260
     tggcagggca acctgcagaa ggcgcgtgaa gacgagaagc tgctgcgtcc ctatgccggt      1320
     gatgacgaga atgatcggga gaagacccag agagcccgag tcgccttccg cagtatcacc      1380
     accgttctgg cggtcaccac cagcgtcgtg gcgccggcga tcgagctggt cgtgatcttc      1440
     ctgccggaga tcctcgggtt tgtgtcgcgc aagctccgcg aggaggagct gcgcaagacc      1500
     atcgacaacc aggttattcc gtcggtgcag cgcgagttcc ggaccaagct gcccgagctg      1560
     ctgcaggcac aggttgatgg cctgatcgag caggccgtgc atgagttcaa gacggccatc      1620
     gaggaaaaac ggcagctgct ggaaagtgtt gtggccgagc agagcagtcc tgcccgcgcg      1680
     gcacgcgtga aagcacttga cgctgcggaa gctggtctga cctccgttgc gaacgaagtc      1740
     gtcgcgctgg agtccgcccg atga                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page