(data stored in ACNUC7421 zone)

EMBL: CP001111.PE374

CP001111.PE374       Location/Qualifiers
FT   CDS_pept        447773..449638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50079"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN6"
FT                   /protein_id="ACF50079.1"
FT                   /translation="MSGDNGRPLFEGTSAQHLTYLAGWKPWGRRLHVTAIQEQMDAASQ
FT                   RWISIVEDHRRLNITAEQRALALAEREAELKHASGALAERETELERASEALAERGTELK
FT                   NVSEALAESETTRSRERDDAQTREQALAGELDAQRQASQELQKELQEAGRRELDLSQRY
FT                   GAEKMARAQLTTSLVDAQDRLKVQSMQHAATQAALESEQEQSRQLGGDLDLLQAEHAAT
FT                   QIRFALVSRLLAVPPPRNEGIEAFQKLLDDDYMRFASAEASLADEAKALRLLQSIQQEL
FT                   HLMAANPDIFRRTVVGVVGGFSSGKSAFINSFLGKDFKLLSSVTPATVIPSYVYPAQQT
FT                   KIQAYSFNGGCIDLDAGFYQEMSRAFVEKFSFDLKRIMPLVSVGTSMDTERTGNICLMD
FT                   TPGYNPGTEGSFSQSDRAVAVSHSRKSDVLFWVIGIDANGTTPDSDIEFLKEIGFEGRP
FT                   VYVVLNKADLRSADQIEEILGQIEDEIELNGITVEGISVYSSKYGKEYEFRGKSMQDFL
FT                   RERPKGRLPMEHVEDRINEVFELYRSAITESIATAKACRSAARALALDLMQGDVQDAAT
FT                   MRSATQNVETINAAMNLDALSRLLVDADQINAAFLDAARRVLTPA"
     gtgagtggtg acaatggcag gccgttgttc gaaggcacca gcgcgcagca ccttacctac        60
     ctcgccgggt ggaagccgtg gggccgtcgg ctccacgtga ccgccatcca ggagcagatg       120
     gatgcagcca gccagcgttg gatctccatc gtggaggacc atcgacggct caacatcacg       180
     gcggagcaac gcgcgcttgc cttggcagag cgggaagctg aactgaaaca cgcatccggg       240
     gctctggcgg agcgcgagac cgaacttgaa cgcgcatcgg aggctctggc ggagcgggga       300
     actgagctga agaatgtgtc cgaggccctg gccgagagtg agaccacccg tagtcgcgag       360
     cgtgacgatg cacagacccg cgagcaggca ctggctggcg aactcgatgc ccagaggcag       420
     gcctcgcagg agttgcagaa ggagcttcag gaagcgggca ggcgcgaact ggacctgagc       480
     cagcgctacg gcgccgagaa gatggcccgg gcgcagctga cgacgagcct ggtggatgcc       540
     caggaccgcc ttaaggtgca gtccatgcag catgctgcaa cccaggctgc gcttgaaagc       600
     gagcaggagc agagccgcca attgggtggc gacctggatc ttctgcaggc cgaacatgcc       660
     gcaacgcaga tccgctttgc gctcgtttcg cgcctgcttg ctgtgccgcc gccgcgaaat       720
     gagggaatcg aagccttcca gaagctgctc gatgatgact acatgcgctt tgcgagtgcc       780
     gaggcgtccc tcgctgacga agcgaaggcg ctgaggttgt tgcagtccat ccagcaggag       840
     ctgcacctga tggcggccaa tccggacatc ttccgccgca cggtcgtggg ggtggtcggt       900
     ggcttcagca gcggaaagtc ggccttcatc aacagcttcc tcggcaagga tttcaagctg       960
     ctctccagcg tcacgccggc aaccgtcatc cccagctacg tgtatcccgc gcagcagacg      1020
     aagatccagg cgtattcgtt caatggcggc tgcattgatc tggatgccgg gttctaccag      1080
     gaaatgtccc gtgcgtttgt cgagaagttc agctttgacc tcaagcggat catgcccttg      1140
     gtaagcgtcg gtaccagcat ggacaccgag cgcaccggca acatctgtct gatggatacc      1200
     cccggctaca acccgggtac cgagggtagt ttcagtcaga gcgaccgcgc ggtagccgtg      1260
     tctcactcgc ggaagtcgga tgtgctcttc tgggtcatcg gaattgacgc caacggtacg      1320
     actccggatt cggatatcga attcctgaag gagattggtt tcgagggacg ccctgtctac      1380
     gtggttctga acaaggccga tctgcgatca gctgatcaga ttgaagagat cctggggcag      1440
     atcgaggacg aaatcgagct gaatggaatc acggttgagg gcatcagtgt ttactcctca      1500
     aagtacggca aggagtacga attccgtgga aaatccatgc aggacttcct gcgtgagcgt      1560
     cccaagggtc gtctgccgat ggagcatgtc gaggatcgga tcaacgaggt gttcgagctt      1620
     tatcgcagtg ccatcaccga atccatcgcg acggcgaagg cctgccgctc ggccgcgcgt      1680
     gcgcttgcat tggacctgat gcagggagat gtccaggatg cggcaaccat gcgttcggca      1740
     acccagaacg tggagaccat caacgcggcg atgaacctcg acgccctgtc cagacttctt      1800
     gtcgatgcgg accagatcaa tgccgctttc ctcgatgcag caagacgggt gctcacgccc      1860
     gcttga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page