(data stored in ACNUC7421 zone)

EMBL: CP001111.PE375

CP001111.PE375       Location/Qualifiers
FT   CDS_pept        450169..451359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50080"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN7"
FT                   /protein_id="ACF50080.1"
FT                   /translation="MPSSLTWLDHDAAAQARSATLLALLDQPGTRDELGFGGIRDALSD
FT                   QLFPGTSVIQTRLRYMLLLPRMFMGLEASSVRPRDFAERARQDELKLNDCLAAEDGAFG
FT                   RDSGHTLKRLASSVYWAGMRSWGIFARSGSQQDYFSAIEQIRRERSWKQQRDDGMEDAE
FT                   LIAQTWHPSLEKLVPVAALEEGSLSLTADEAEFIREQWKVHHPQTLLVWLAQDKGRLGD
FT                   CADAGFPWLHPQIRQAPQPLRELVEHARQFSRLANGASLVYNLALAEASSNDERREEYG
FT                   QELKTWIDGVPASQLGEWDMVQFWEQVERVGRPIHPRTREFVSSWLALVKAGQADSPQS
FT                   RSLVRERERSLKGNLSRFNPENLDRWSGASGLGILNYRWGITRRHLADLLHGLEAA"
     atgccttcca gcctgacatg gctcgaccat gacgctgcgg cacaggcacg cagcgctacg        60
     ctgctggccc ttctggacca gcccggcacc cgcgacgagc tcggatttgg cggtatccgc       120
     gatgcgttgt ccgaccagct gttccccggc acctccgtca tccagacgcg gctgcgatac       180
     atgcttctgc tgccgaggat gttcatgggc ctggaggctt cttcggtacg ccccagggat       240
     tttgcagagc gtgcgcggca ggatgagctg aagctcaatg attgcctggc ggcggaggac       300
     ggggcgttcg gtcgtgattc cggccacacg ctcaagcgcc ttgccagctc cgtctactgg       360
     gcgggcatgc gctcctgggg catcttcgcg cgatcgggct cccagcagga ctacttctcg       420
     gccatcgagc agattcgcag ggagcgcagc tggaagcagc aacgcgacga cgggatggag       480
     gacgctgagc tgattgcaca gacctggcat ccctcactgg agaagctcgt accggtggcc       540
     gcactggaag agggatcgct gtccctgacc gcggacgagg cggagttcat ccgcgagcaa       600
     tggaaggttc atcacccgca gaccctgctg gtgtggctgg cgcaggacaa ggggcgattg       660
     ggcgactgtg ccgacgccgg gttcccatgg ctgcatccac agatccgcca ggctccgcag       720
     ccgctgcgtg agctcgtgga acacgcgcgt cagttctccc gtctcgccaa cggtgcgtcg       780
     ctggtctaca accttgccct ggcggaggcg tcttccaacg atgaacgtcg tgaggagtac       840
     ggccaggaac tgaagacctg gatcgacggc gttccggctt cgcagctggg cgaatgggac       900
     atggtgcagt tctgggagca ggtggaacgg gtggggcgtc cgattcatcc gcgcacccgc       960
     gagttcgtga gcagctggct tgcgctggtc aaggccggcc aggccgacag cccgcagtca      1020
     cgcagtctcg tgcgtgagcg ggagcgctcg ctgaaaggca atctctcgcg cttcaatcct      1080
     gaaaacctcg atcgctggag cggtgcgtcc ggcctcggaa tcctcaatta ccggtggggc      1140
     atcacgcgcc gtcaccttgc cgacctcctg cacggcctgg aggccgcatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page