(data stored in ACNUC7421 zone)

EMBL: CP001111.PE376

CP001111.PE376       Location/Qualifiers
FT   CDS_pept        451356..453194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50081"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN8"
FT                   /protein_id="ACF50081.1"
FT                   /translation="MIHPSARSTLTEALQPPSGYRFDAGVATTYSLSLGALLGLPAHFA
FT                   LLGDHDNSAEEDPLRLVEGLRRASRRLAVFCERGRMEAPPAGNALAVLAEGMVHEVCAP
FT                   HGGAFHPKIWALRYVAIDAAAEPATVVRLLVLTRNLTWDRCWDVSLRLDGVPGKAKEAS
FT                   NKPLADFLRWLPLNTEGASPDLERQAMIVSLAKDIERADWEKPPGFTQLAFHVLGTAKR
FT                   AVPWSPLEGGGKAQDVLIVSPFVRAGALQTLREHCNGDFMLVSRADELDRLPAGACLAD
FT                   DSAYVLKPDTLLSEGEEAGQADTLQGLHAKVAVFQRGQRVHVAVGSANYTNAVVQNGSN
FT                   VEVVAELSGPVSRIPAPRQWLDEHLQPLLDTYTPGGGEDAEGAERRQLQDQLEAIRRQI
FT                   AAAAWTLHCETHPVSGWNLALSCPGLPLDGATLHAWPLAVVSERARPVQAGQVDLGTFA
FT                   GHEVSSLVGFQVTPNSTRAEELAVPPLRFALEVSLEGAPDDRADALVAQLLGNRAAFLR
FT                   YLALLLDDPQAAGCGARNRSEGSGGGSRDASGLMANYPLFEQLLRIYSREPERLEAIDR
FT                   MVKRLKDKQFDGQPCLPDDFLALWEVVGNAIGKEAA"
     atgatccatc catctgcacg cagtactctg accgaggcct tgcagccccc cagcggctac        60
     cggtttgatg ccggcgtcgc cactacgtac agcctgtcgc tgggcgcgtt gctgggattg       120
     cctgcacatt tcgctttgct cggcgaccac gacaacagcg ccgaagaaga tcctttgcgc       180
     ctcgtggaag ggctgcgccg ggcaagccgc aggcttgcgg tgttctgcga acggggacgg       240
     atggaagcac cgccagcagg caacgcattg gcggtgctgg ctgagggcat ggtgcatgag       300
     gtctgcgccc cacacggcgg cgccttccac ccgaagatct gggcgctgcg ctatgtggcc       360
     atcgatgcgg ccgccgaacc tgccaccgtc gtacgtctgc tggtgctgac ccgcaatctg       420
     acctgggacc gctgttggga cgtgagcctg cgcctggatg gtgtgccagg aaaggccaag       480
     gaggccagca acaagccgct ggcggacttc ctgcgctggc tgccgctgaa taccgaaggg       540
     gcgtcgccgg acctggagcg gcaggcgatg atcgtatcgt tggcgaagga catcgagcgc       600
     gctgactggg aaaagcctcc gggcttcacc cagctggcgt tccacgtgct gggtactgca       660
     aagcgggccg tgccgtggag tccgctcgag ggcggtggca aggcccagga tgtgttgatc       720
     gtctctccct tcgtacgcgc tggcgcgctg cagacgctgc gcgagcactg caacggcgac       780
     ttcatgctgg tgagtcgcgc cgatgagctg gataggcttc cggccggcgc ctgcctggcc       840
     gatgacagtg cctacgtgtt gaagcccgac acgctgctct ccgaaggtga agaggctgga       900
     caggccgata cgctgcaggg cctgcacgcc aaggtggccg tgttccagcg cggccaacgg       960
     gtgcacgttg cagtcggttc ggccaattac accaacgcgg ttgtgcagaa cggcagcaac      1020
     gttgaagtgg ttgcggagct gagtggtccg gtgagcagga ttcccgcgcc gaggcagtgg      1080
     cttgacgagc atcttcagcc cttgctggac acgtacacgc ccggtggggg cgaagatgcg      1140
     gagggcgcag agcgtcgcca actgcaggac cagctggagg ccatccgtcg ccagattgct      1200
     gctgccgcct ggacgctgca ctgcgaaacc catccggtct cgggatggaa cctcgcgctt      1260
     tcgtgcccgg gccttccgct tgacggtgcc acgctgcacg cgtggccgtt ggcggtggtt      1320
     tccgagcggg cccgtcctgt acaggcgggt caggttgatc tgggaacctt tgccggccat      1380
     gaggtgagtt cgctggttgg cttccaggtc acgcccaaca gtacccgcgc cgaggagctg      1440
     gccgtcccgc cgttgcgctt cgcgctggaa gtttcactgg agggcgctcc agacgaccgc      1500
     gcggacgcgc tggtggcaca actcctgggt aaccgcgcgg cgttcctgcg ctatctcgcg      1560
     ctgctgctgg atgatcccca ggccgcaggc tgtggagcgc gcaatcgatc cgaaggcagc      1620
     ggcggcggca gcagggatgc gagtggcctc atggcgaact acccgctgtt tgaacagctg      1680
     ctgcggatct attcccgcga gcctgaacga cttgaagcga ttgatcgcat ggtgaagcgg      1740
     ttgaaggaca agcagttcga tgggcagccc tgtctgcccg atgatttcct ggccctctgg      1800
     gaagttgtgg gaaacgctat tggcaaggag gctgcgtaa                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page