(data stored in ACNUC7421 zone)

EMBL: CP001111.PE378

CP001111.PE378       Location/Qualifiers
FT   CDS_pept        complement(456460..457752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50083"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP0"
FT                   /protein_id="ACF50083.1"
FT                   /translation="MGELTRKDLEILREYADSGNRERYWSYLAHKEHSDGYGLLALGVV
FT                   RNDNLPGQVANAYAQSQARDQHDRNPALQNRNLTEREWEAFGQTLLHRDLERREHWMEA
FT                   KRPDLALNLPGRDVQQAHDEAFKRHHLDPNCWTPRVLLEATRKERGEGKAEEVWKEMLN
FT                   NDVGGTQRAANTLGSAYLAMPFWSATGYVGRLGLYEGSLMAEALPSSDPNVIGSRSSYH
FT                   MYSEKEQAWYLQVPGSIPLREHNPRIIASLDDARAVRLERAEKATHFHPEDSYRTRLET
FT                   PKVVMNEPLERDGRETQLAANRPDHANDPVYQQIRGQVASLQAEHGLVLGNNPDGVTAR
FT                   LAVLAKENNLSQVDHVMLGKANGPGGAGQNLFLVQGALDDPAHLRVAISAEQAVQAPVE
FT                   HSYRQLDALAQRQAQDVESAQQVQRDAMRMA"
     atgggtgaat tgacccgcaa ggatctggag atcctcaggg aatacgcaga cagcggaaac        60
     cgcgagcgct actggagcta cctggcgcac aaggaacatt ccgatggcta cggtctgctg       120
     gccctgggcg tggtgcgcaa cgacaacctg ccgggccagg tagccaacgc ctacgcgcag       180
     tcgcaggccc gtgaccagca cgaccgcaac ccggccctgc agaaccgcaa cctgaccgag       240
     cgcgaatggg aggccttcgg ccagaccctg ctgcaccgcg acctggaacg ccgcgagcac       300
     tggatggagg ccaagcgccc cgatctggcc ctgaatctgc ccggccgcga tgtgcagcag       360
     gcgcacgatg aagccttcaa gcgccaccac ctcgacccca actgctggac cccgcgtgtg       420
     ctgctggaag ccacccgcaa ggaacgcgga gagggcaagg ccgaggaagt ctggaaggag       480
     atgctcaaca acgacgtcgg tggtacccag cgcgcggcca acacgctggg cagcgcgtac       540
     ctggccatgc ccttctggag cgccaccggc tatgtcggcc ggctgggcct gtacgaaggc       600
     tcgctcatgg ctgaggcact gcccagcagc gatcccaatg tcatcggctc gcgcagttcg       660
     taccacatgt attcggaaaa ggagcaggcc tggtacctgc aggtgccagg cagcatccca       720
     ctgcgtgagc acaacccgag gatcatcgcc tcgctggacg acgcccgtgc cgtgcgcctg       780
     gagcgcgcgg agaaggccac gcacttccac cccgaggaca gttaccgcac ccgccttgaa       840
     acgcccaagg tggtgatgaa cgagccgctg gagcgcgatg gccgcgaaac gcagctggcc       900
     gccaaccgcc ccgatcacgc caacgaccct gtgtaccagc agatccgcgg ccaggtggcc       960
     agcctgcagg ccgagcacgg cctggtgctg ggcaacaacc ctgatggcgt gaccgcgcgc      1020
     ctggcggtgc tggccaagga gaacaacctc agccaggtgg accacgtgat gctcggcaag      1080
     gccaacggcc ctgggggtgc ggggcagaac ctgttcctgg tgcagggcgc gctggatgat      1140
     ccggcccacc tgcgggtggc catctccgcc gaacaggccg tgcaggcgcc ggtcgagcat      1200
     agctaccggc agctggatgc gctggcgcag cggcaggcgc aggatgtgga aagcgcgcag      1260
     caggtgcagc gggacgcgat gcggatggcg tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page