(data stored in ACNUC7421 zone)

EMBL: CP001111.PE379

CP001111.PE379       Location/Qualifiers
FT   CDS_pept        complement(457780..458640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50084"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP1"
FT                   /protein_id="ACF50084.1"
FT                   /translation="MNLPPPGRWLALAIALASSTACSKAPSKEPEHRETPMTDTAQSHT
FT                   VDGYTYTTAPVEATLGPHRYAFPANLYDDQMGPAVGGGIGLTLLWPDLQAAPPGTRASR
FT                   SMSDHHRAISLSLDYIDALPIAELLPRKTSTEATTEDGSINRDDPRRRLDLRNAGTPHF
FT                   GLTPYAIDEARMTRFSEAYAAQRGTPPVRTPETDQEWYIARDTQGALATFITCNPPQDG
FT                   REGLTVQGTTLVDDPDVPVATCTHTFTDPQDGLSVRAIYPRVLLKDWKAVEDATRVLLA
FT                   RYKLR"
     atgaacctgc caccgccggg ccgctggttg gccctggcca tcgccttggc aagcagcacg        60
     gcctgcagca aggccccctc caaggaaccg gagcaccggg agacccccat gaccgacacc       120
     gcacagtccc acaccgtgga cggctacacc tacaccaccg cccccgtgga agccacgctg       180
     ggcccacacc gctacgcctt ccccgccaac ctgtacgacg accagatggg tccggcggtg       240
     ggcggcggca tcggcctcac cctcctgtgg cccgacctgc aggcggcacc gccgggcacg       300
     cgcgcctcgc gcagcatgtc cgaccaccac cgcgccatca gcctgtcgct ggattacatc       360
     gacgccctcc ccatcgccga gctgctgccg cgcaagacca gtaccgaagc gaccaccgag       420
     gacggctcga tcaaccgtga cgacccgcgc cgccggctgg acctgcgcaa cgccggtacg       480
     ccgcacttcg ggctcacccc gtacgccatc gacgaagccc gcatgacgcg gttttccgag       540
     gcgtatgccg cgcagcgcgg cacgccgccg gtgcgcacgc ccgaaaccga ccaggagtgg       600
     tacatcgccc gcgacacaca gggcgcgctg gccaccttca tcacctgcaa tccgccgcag       660
     gatgggcgcg aggggctgac cgtgcagggc accacgctgg tggatgaccc cgatgtgccg       720
     gtggccacct gcacgcatac cttcaccgac ccgcaggatg ggctgtcggt gcgcgcgatc       780
     tacccgcgcg tgctgctcaa ggactggaag gccgtggagg acgccacgcg cgtcctgctg       840
     gcccgctaca agctgcggta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page