(data stored in ACNUC7421 zone)

EMBL: CP001111.PE381

CP001111.PE381       Location/Qualifiers
FT   CDS_pept        459952..461097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50086"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP3"
FT                   /protein_id="ACF50086.1"
FT                   /translation="MFRNPLFRSAALAVAVSLSLGVPSAFADNAPTASATAAVQRQAVA
FT                   KGLYELAYSPKQNAVFVASSGGFGDDAGPAQVLRLNPTTLAVETRIPLERKAFGVVLDD
FT                   TQNRLYVGNTVDLSVTVVDTAQNKAVGTIQLMEKKTGKDGKAAYTHDLRELVVDSAANR
FT                   LYLTGHSSQPDVSSVLFVIDTTTLKVVNTIDGLGYAKAPGLALDAANKRVYTSNLLADL
FT                   VVVGTDSNKVVAQHKIAAEQPMNIALDPAGKRLFVTDQGSEFLRGYQTKSSGLVSKHPG
FT                   QRVLVLDRSTGKELASIPTDAGPLGILLDAPRKRLYVTNREAGTVTAYNSDSYQKVATY
FT                   TVPTHPNSLALDAKNNVLFVSIKNGEKDDKGADESVARIQL"
     atgttccgta atcctctctt ccgctcggcc gccctggccg ttgccgtttc gctcagcctc        60
     ggcgtgccct ccgcgttcgc cgacaacgcc cccaccgcca gtgccaccgc cgccgtgcag       120
     cgccaggctg tggccaaggg gctgtacgag ctggcctaca gcccgaagca gaatgccgtc       180
     ttcgtggcct cgtccggtgg cttcggcgat gacgccggcc cggcccaggt gctgcgcctg       240
     aacccgacca cgctggccgt ggaaacccgc atcccgctgg agcgcaaggc gttcggcgtg       300
     gtgctggatg acacccaaaa ccgcctgtac gtgggcaaca ccgtggacct gtcggtgacg       360
     gtggtcgaca ccgcgcagaa caaggccgtc ggcaccatcc agctgatgga gaagaagacc       420
     ggcaaggatg gcaaggccgc ctacacccac gacctgcgcg agctggtggt cgacagcgcc       480
     gccaaccgcc tgtacttgac cggccacagc agccagccgg acgtgagcag cgtgctgttc       540
     gtgatcgata ccaccacgct gaaggtggtc aacaccatcg acggcctggg ctatgcgaag       600
     gcgccgggcc tggcgctgga tgcggccaac aagcgcgtct acaccagcaa cctgctggcc       660
     gacctggtgg tggtgggcac cgattcgaac aaggtggtgg cacagcacaa gatcgccgcc       720
     gagcagccga tgaacatcgc tctggatccg gcaggcaagc gcctgttcgt gaccgaccag       780
     ggctcggaat tcctgcgtgg ctaccagacc aagagcagcg gcctggtcag caagcatccg       840
     ggccagcgcg tgctggtgct cgatcgcagc accggcaagg aactggccag catcccgacc       900
     gatgccggtc cgctgggcat cctgctggat gcaccgcgca agcgcctgta cgtgaccaac       960
     cgcgaagcgg gcacggtgac cgcctacaac agtgacagct accagaaggt ggccacctac      1020
     accgtgccga cccacccgaa cagcctggcg ctggatgcga agaacaacgt gttgttcgtg      1080
     agcatcaaga acggcgagaa ggacgacaag ggcgctgacg agagcgtggc gcggattcag      1140
     ctgtaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page