(data stored in ACNUC7421 zone)

EMBL: CP001111.PE382

CP001111.PE382       Location/Qualifiers
FT   CDS_pept        461241..461816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1271 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50087"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP4"
FT                   /protein_id="ACF50087.1"
FT                   /translation="MMGIHRWLRAGLIFTLAGALGACNSRIPDAPEPLDLVKPIIVAEP
FT                   GQAVRFEFETNARNFHPGRTYALELEVEHQGPEDTREPSIATMQIPFEVSLQRLTAGTW
FT                   QDVATYDSYQAMARNAGEALPEWHASSEWRYTSPHMGSDGQYTLSLVALPMEINSRYRV
FT                   DVRTVQRTAALQDYSARLRIHAARPAGK"
     atgatgggta tccatcgctg gctgcgtgcc ggcctgatct tcacgctggc gggcgcactc        60
     ggcgcctgca acagccgcat accggatgcg ccagagccgc tggatctggt caagccaatc       120
     atcgttgccg agcccggtca ggcggtgcgg ttcgagttcg agacgaatgc ccgcaacttc       180
     cacccgggtc gcacctatgc gctcgagttg gaagttgagc atcaggggcc ggaagacacc       240
     cgcgagccca gcatcgccac aatgcagatc ccctttgagg tgtccctgca gcggttgacc       300
     gcaggtactt ggcaggacgt tgcgacctac gacagctacc aggcaatggc tcgcaacgcg       360
     ggggaagcgc ttccagaatg gcatgcatcc agcgaatggc ggtatacgtc gccgcacatg       420
     gggagtgacg gccagtacac gctgagcttg gttgctctgc caatggaaat taactcccgc       480
     taccgcgtgg acgtgcgtac ggtgcagagg accgcggcac tgcaggatta ctcggcccgt       540
     ttgcggatcc atgccgcccg tcccgccgga aagtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page