(data stored in ACNUC7421 zone)

EMBL: CP001111.PE383

CP001111.PE383       Location/Qualifiers
FT   CDS_pept        461894..462469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1271 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50088"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP5"
FT                   /protein_id="ACF50088.1"
FT                   /translation="MLGIHRWLLAGLIFTLAGALGACNSRIPDAPEPLDRVKPIDVAEP
FT                   GQEVRFEFETNARNFHPGRPYVLDLEVQRHGPAPDSEPDMDSLHVPFQLYLQRWVAGAW
FT                   QDVATSDVHQATTSNLGEPLPEWHASAGWRYAQQVSMDASRYRLSIVTLPMEMGARYRL
FT                   EVRTVQPTAALQHYPAQLRVHADPLSGK"
     atgctgggta tccatcgctg gttgcttgcc ggcctgatct tcacgctggc gggcgcactc        60
     ggcgcctgca acagccgcat accggatgcg ccagagccac tggatcgggt caagccgatc       120
     gacgttgccg aacccggcca ggaggtgcgg ttcgaattcg agacgaatgc ccgcaacttc       180
     catccgggtc gaccctatgt gctggatctt gaggtgcagc gacacggacc cgcgcctgac       240
     agtgagcctg acatggacag tcttcatgtt cccttccagc tttacctgca gcgctgggtc       300
     gcaggtgcct ggcaggacgt cgcaacctct gatgtccatc aagcaacgac gagcaatctg       360
     ggtgagccgc tgcccgaatg gcatgcatcg gcaggctggc gctacgcgca gcaggtatcg       420
     atggacgcca gccgatatag gttgagcatc gtcaccctac cgatggaaat gggtgcccgc       480
     taccgactgg aagtgcgcac ggtgcagccc accgccgcgc tccagcatta cccggctcag       540
     ctgcgggtcc atgccgaccc tctctctgga aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page