(data stored in ACNUC7421 zone)

EMBL: CP001111.PE384

CP001111.PE384       Location/Qualifiers
FT   CDS_pept        462510..463577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50089"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP6"
FT                   /protein_id="ACF50089.1"
FT                   /translation="MDKPRYAVEIIIAAPGTPLIDKKTGSQEVIDGVPQTSGPGHMFYV
FT                   LRAPGQQPQSYGFAPIEHGSVNGQGKVMNDDATIYKDPHYSRTLEISEEQYRKLEAFGT
FT                   YPSKYGFDLQYKDVRHNCVDFTWEALNHAGIERKRSIDVNALGGGIGQLLPDVRIPLES
FT                   KGAGKDGFRPLRNIHGVDSIDPPFPDSELNQKKTNPLPARSFQQRILSDAEGVGERSGD
FT                   HLARHGNDLLLSQIHQGVALLDAERGRAFDATSENISASLYALAKANGLTQVDHVLVSD
FT                   RTAQADVAQNIFIVQGERDDPAQLRASMPTAVAAQTPAETSFERAEQLSQSAQSRTQDE
FT                   LQQRQVQEQSGPRMA"
     atggacaagc cacgttacgc cgtcgagatc atcatcgccg cccccggtac gccgttgata        60
     gacaagaaga ccggtagcca ggaagttatt gatggggtgc cgcagacttc cgggccaggc       120
     cacatgttct acgtgcttcg tgcgcccggt cagcagcctc agagctatgg gtttgcaccc       180
     atagaacacg gaagcgtgaa cggccaaggc aaggtcatga atgatgatgc gacgatctac       240
     aaggaccccc attacagccg cactctcgaa atcagcgagg agcagtacag gaagcttgaa       300
     gcgttcggca cgtacccaag taagtacggc ttcgatctgc aatacaagga cgtgcggcac       360
     aactgcgtgg acttcacctg ggaagcgctt aaccatgcag gcatcgagcg gaaaagaagc       420
     atcgacgtga acgcgctggg aggcggtatt ggccaattgc ttcccgatgt ccgtattccc       480
     ttggagagca agggcgcagg caaggatgga ttccgaccgc tgcgcaacat ccatggtgtg       540
     gacagcattg atccgccgtt tccggacagc gagctcaatc agaagaaaac caatcccttg       600
     cccgcgcgca gcttccagca acgcatcctg agcgacgctg agggcgtggg cgaacgaagc       660
     ggtgatcatc tcgccaggca cggcaacgat ttgctgctct cgcagatcca ccagggcgtg       720
     gccctgctcg atgcagagcg gggccgcgcc ttcgatgcca ccagcgagaa catcagcgcc       780
     agcctgtacg ccctggccaa agcgaacggc ctgacccagg tcgaccacgt gctggtgagc       840
     gatcgcacgg cgcaggccga tgtggcgcag aacatcttca tcgtgcaggg cgagcgcgac       900
     gacccggcac agctgcgcgc cagcatgcca actgcggtgg ccgcgcagac accggcggaa       960
     acctcgttcg agcgtgccga gcagctgtcg cagtctgcgc agtcgcgcac gcaggatgag      1020
     ctgcagcagc gccaggtgca ggagcagtcc gggccgcgta tggcctag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page