(data stored in ACNUC7421 zone)

EMBL: CP001111.PE385

CP001111.PE385       Location/Qualifiers
FT   CDS_pept        complement(463641..464057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50090"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP7"
FT                   /protein_id="ACF50090.1"
FT                   /translation="MADITPNHPEYGLNQQIRQGVAALDAQHGRPFDQTSERLTASLTV
FT                   LAREQGLQQVDHVLVSNATGNHPAGHNIFVVQGDPANPAHLRAMMPTAVAAQTPVEQSM
FT                   QKLGIAPQQPAMGQLPEQQAREQEQQQNPAHRLG"
     atggcagaca tcacccccaa ccaccccgag tacggcctca accagcagat ccgtcagggc        60
     gtggccgcac tggacgccca gcatggccgt ccgttcgacc agaccagcga gcgcctgacc       120
     gccagcctga ccgttctcgc ccgcgaacag ggcctgcagc aggtcgacca tgtgctggtc       180
     agcaacgcca cgggcaatca tccagctggg cacaacatct tcgtggtgca gggcgacccg       240
     gccaatcccg cgcacctgcg cgcgatgatg ccgaccgctg tggcggcgca gacgccggtg       300
     gagcaatcga tgcagaagct gggcattgcc ccgcagcagc ccgccatggg gcagctgccc       360
     gaacagcagg cccgtgagca ggaacagcag cagaacccgg cacaccgcct gggttga          417
//

If you have problems or comments...

PBIL Back to PBIL home page