(data stored in ACNUC7421 zone)

EMBL: CP001111.PE388

CP001111.PE388       Location/Qualifiers
FT   CDS_pept        465764..466714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu4879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50093"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ0"
FT                   /protein_id="ACF50093.1"
FT                   /translation="MATELAFSIEFNDTINAERAYELYWADVITDKRAFLCPEHESGCP
FT                   AKYTCANMDTEQLQLKQVPHFRNQHDSELHMEGCPHVAELDVRGCSGESRPSEVGQPAP
FT                   DRFLLTRPVGHFDVRQGTASETDFGAGGRSGSGEASGTRSRRTQFYSLAALVSRWLKAR
FT                   QDNMDDTMIVSAGTQEPMTYRELFENFFEKRPYLSGNTRVYWSKAWIRKTDDGFKIIFC
FT                   EPITALVGEMLAEPLRPSAMVWNSVLAASEMKSLHARRLQRFAESEAPCVVFLYGTPAL
FT                   QEKHSRTYLNFDVKSLDLVDVQGTDIFDRIRRPQD"
     atggcaacgg aactagcttt cagcattgaa tttaacgaca ccatcaacgc agagcgcgcc        60
     tacgagctgt actgggcgga cgtgattacg gacaagcgcg cgtttctttg ccccgagcac       120
     gagagtggct gtccagcaaa gtacacctgc gcgaacatgg ataccgagca gcttcaattg       180
     aagcaggtgc cccacttccg caatcagcac gatagcgagc tgcacatgga gggctgcccc       240
     cacgtcgctg agctcgacgt gcggggatgt agcggagaaa gccgtcccag cgaagtggga       300
     cagccggcgc cagaccgatt tcttctgacg cgccctgtgg gacatttcga tgttcgccag       360
     ggtacagcga gtgagactga ctttggtgcc ggcggccgca gcggcagcgg ggaagcaagc       420
     ggaacgcgca gccgtcgcac ccagttctac tcgctcgccg cgctggtatc gcgctggctc       480
     aaggccaggc aggacaacat ggatgacacg atgattgtca gcgcaggtac acaggaacca       540
     atgacctatc gggagctgtt cgagaatttc ttcgagaagc gtccttacct ttctgggaac       600
     acgcgcgtgt actggagtaa ggcatggatc cggaagacag acgatggctt caagatcatt       660
     ttctgtgaac cgatcacggc ccttgtcggc gaaatgctgg cggaaccttt gcgtccctct       720
     gcgatggtgt ggaacagcgt cttggcggca tcggagatga aatccctgca tgccaggcgt       780
     cttcagcgct tcgcggaaag cgaagcaccc tgcgtggtat tcctctatgg gactcccgcg       840
     ctgcaggaga agcactcacg gacctatctg aacttcgacg tgaagagctt ggatcttgtt       900
     gatgtgcagg gtaccgatat ctttgacagg atccgacgtc cccaagactg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page