(data stored in ACNUC7421 zone)

EMBL: CP001111.PE389

CP001111.PE389       Location/Qualifiers
FT   CDS_pept        466959..467576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50094"
FT                   /db_xref="GOA:B4SHQ1"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ1"
FT                   /protein_id="ACF50094.1"
FT                   /translation="MSDVAMLLDAGLPVAVVAVISGVVLGAKVVQALCAYLRQGRKECL
FT                   ELWDRSKVDDAFWLESYINHRYNVRSPPADLVRACLEAGNSTTMMRDLVMNWRFFQGNS
FT                   LPTLRWRGASRNHPILLWVELAMLPLVYFGFVVLGLLVIDKGGERGIVAAGPLIALGAL
FT                   SFWSFLTLIGARRALSDLRRQDETDERVSLSHPPADKHRALG"
     atgagtgacg tggcgatgtt gttggatgct gggcttcccg tagctgtcgt cgcggtgatc        60
     agtggcgtag tgctcggcgc gaaagtagta caggcgctat gcgcgtacct tcgtcagggg       120
     cgaaaggagt gtctggagct gtgggatcgc tcaaaggtag atgatgcgtt ctggctggag       180
     tcatatatca accatcgata caacgtgcgt tctcccccgg cggatctggt tcgagcgtgc       240
     ctagaggcag gtaattcgac aacgatgatg agggatcttg tcatgaactg gcgattcttc       300
     cagggaaatt ccctgcctac attgcgctgg cgtggcgcca gcaggaacca cccgattctt       360
     ctctgggttg agctggcgat gctccctctg gtctattttg gtttcgttgt tctgggccta       420
     ttggttatcg acaaaggggg ggagaggggg attgtggctg cgggcccgtt gattgcattg       480
     ggtgcactga gcttctggtc gttcctgaca ttgatcggcg cacgaagagc gctatctgat       540
     ctgagaaggc aggatgaaac agatgagcgg gtttcgttgt cgcatccgcc agccgacaag       600
     cacagggcgc ttggttag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page