(data stored in ACNUC7421 zone)

EMBL: CP001111.PE390

CP001111.PE390       Location/Qualifiers
FT   CDS_pept        467606..468265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50095"
FT                   /db_xref="GOA:B4SHQ2"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ2"
FT                   /protein_id="ACF50095.1"
FT                   /translation="MVSAASRFCRICGPGPILMVLQVVALLSMALAAGFFHYRVDLLLE
FT                   PVDETCGGPDPVARMQVAEQLMARSLALEPWQPLHWIPLAGVTLAMLGAMSISLYRLGR
FT                   LPGRLRLANWGMMALHGAILALASWALRLYDTAWTSVATLSPAACLVELGEQGRLPLAQ
FT                   AQQVVFEILTHEHAPLLRNPDDLALVLVALMLTAMTAGFMLWRAIVRIREAELPAA"
     atggtctctg ccgcttcgcg cttctgccgc atctgtggtc ccggcccgat cctgatggtg        60
     ctgcaggtgg tggcgctgct gtcgatggcg ctggcagccg gcttcttcca ctaccgcgtg       120
     gatctgctgc ttgagccggt ggatgaaacc tgcggcggcc cggatccggt ggcacgcatg       180
     caggtggcgg agcagttgat ggcccgttcg ctcgcgcttg agccttggca gccgttgcat       240
     tggattccgc tggccggcgt gacactggcc atgctgggcg cgatgtcgat cagtctctat       300
     aggctcgggc gcctgccggg gagactgcgt ttggccaact ggggaatgat ggcactgcat       360
     ggcgcgatac tggcattggc cagttgggcg ctgcgtctgt acgacacggc gtggaccagc       420
     gtggcgacgc tgtctcctgc ggcgtgcctg gtggaactgg gcgagcaggg caggttgccg       480
     ctggcgcagg cgcagcaggt ggtgttcgag atcctcaccc atgagcatgc gccgctgctg       540
     cgcaaccccg atgatcttgc cctggtgctg gtcgcgctga tgctgacggc gatgactgcg       600
     ggattcatgc tgtggcgggc gatcgtgcgg atacgcgagg cggagttgcc tgcggcgtag       660
//

If you have problems or comments...

PBIL Back to PBIL home page