(data stored in ACNUC7421 zone)

EMBL: CP001111.PE393

CP001111.PE393       Location/Qualifiers
FT   CDS_pept        complement(470669..471331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ5"
FT                   /protein_id="ACF50098.1"
FT                   /translation="MKLQIAILTFIVSASVQAGDGAPADGQIADEAKTPSRIVRSAEWP
FT                   DFIGGTISVEQSLNRNSKGQYVYRYDDQTEATKQYHEASCADIGMNPAKGESITVGPGS
FT                   AAWHCSSIESNSASDAKSTDYVIAYAPNGQVSAGQNFISYGTVRFNSSVSGNIQGSAQI
FT                   DNGRCHTFYNEYYPPNTVGSHTARVLCFAHAPQTMNTLMEGCVPRACASNRGSIRAN"
     atgaaactgc agatagcgat tctcacgttc attgtctctg catccgttca ggcaggagac        60
     ggagctccag ctgatggaca aatcgctgac gaagcaaaga ccccatcaag aatcgtccgc       120
     agcgcggaat ggcctgactt cattggggga acgatcagtg tggagcagtc cctcaatcgc       180
     aactcgaagg gacagtatgt atatcgctac gacgatcaaa cggaagcgac gaagcagtat       240
     cacgaggctt cctgcgcgga tatcgggatg aaccccgcca agggcgagtc catcacagtg       300
     gggccaggaa gcgccgcgtg gcattgctca agcatcgagt cgaacagtgc tagcgacgca       360
     aagagtactg actatgtaat cgcctatgca cccaatggac aggtatcagc tggccagaac       420
     ttcatttcct acggaaccgt aagattcaac agctcagtca gcgggaacat ccagggtagc       480
     gcgcaaatag acaacgggag gtgccatacc ttctataacg agtattaccc accaaacaca       540
     gtgggtagcc ataccgcaag agtactctgc ttcgctcatg ccccacagac aatgaatacg       600
     ttgatggaag gctgtgtacc gcgtgcctgt gcaagcaatc gcggctccat cagagccaac       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page