(data stored in ACNUC7421 zone)

EMBL: CP001111.PE394

CP001111.PE394       Location/Qualifiers
FT   CDS_pept        complement(471443..471859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ6"
FT                   /protein_id="ACF50099.1"
FT                   /translation="MRTLRLLLPGALLLLTACSGDAGLPFSADPLQGCFATSARKPADF
FT                   RIEKEGGQYFVSFSRGEQWQREPNALHKATRSEISRYFRDDADQIDSALIRMAGGFGIF
FT                   HFNKGATLKGKASDSDYMALMLIGAGPVYAVKCQ"
     atgcgcacgc tccgcctgct gctgcccggt gccctcctgc tgctcaccgc ctgcagtggt        60
     gatgccgggc ttcctttcag cgccgacccg ttgcagggct gcttcgccac cagtgcgcgc       120
     aaaccggccg acttccgcat cgagaaggaa ggcggccagt acttcgtctc cttcagccgt       180
     ggcgagcagt ggcagcgcga gccgaatgcc ctgcacaagg ccacccgcag cgagatcagc       240
     cgctacttcc gcgacgacgc cgatcagatc gacagcgccc tgatccgcat ggccggtggc       300
     ttcggcatct tccacttcaa caagggcgcg acgctgaagg gcaaggccag cgacagtgac       360
     tacatggcac tgatgctgat cggggctggg ccggtgtatg cggtgaagtg ccaatag          417
//

If you have problems or comments...

PBIL Back to PBIL home page