(data stored in ACNUC7421 zone)

EMBL: CP001111.PE396

CP001111.PE396       Location/Qualifiers
FT   CDS_pept        complement(472323..473297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0396"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: xcb:XC_4064
FT                   heavy metal transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50101"
FT                   /db_xref="GOA:B4SHQ8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ8"
FT                   /protein_id="ACF50101.1"
FT                   /translation="MQLDALAAARRHEHRFDDGNPLAERNTRRALWLTVAMMLVEIVGG
FT                   WWFNSMAVLADGWHMSSHALALGLSVFAYRCARRYAHDPRFAFGTWKIEILAGYTSAIA
FT                   LLGVAALMAVQSLERLWVPAPIHYNEAIAIAAVGLGVNLLCAWWLHDSPGHAHHHHGHG
FT                   HNHHHGHDHDHHDHSHAHGHDLNLRSAYVHVLADAATSVLAIVALLGGKLLGLTWLDPV
FT                   MGLVGAVLVTVWAIGLLRDSGRILLDAQMDAPVVAEVREVIEQGPWPARLADLHVWQVG
FT                   RGKYAVSASVVTSDASLDADTVRNALAIHEELVHVTVEIHRSA"
     atgcaattgg acgccctagc cgccgcccgc cgccacgaac accgcttcga cgacggcaac        60
     ccgctggccg aacgcaatac ccgccgcgcc ctgtggctca ccgtcgccat gatgctggta       120
     gagatcgtcg gcggctggtg gttcaactcc atggccgtgc tcgccgacgg ctggcacatg       180
     agttcgcacg cgctggcgct gggcctgtcg gtgttcgcct accgctgtgc gcggcgctat       240
     gcacacgatc cgcgcttcgc cttcggcacc tggaagatcg agatccttgc cggctatacc       300
     agcgccatcg cactgcttgg tgttgccgcg ctgatggccg tgcaatcact ggagcggctg       360
     tgggtaccgg cgccgatcca ctacaacgaa gccatcgcca tcgcggcggt agggctgggc       420
     gtgaacctgc tctgcgcctg gtggctgcac gacagcccgg gccacgcgca tcaccatcat       480
     gggcatgggc acaaccatca ccatgggcat gatcacgatc accacgacca cagccatgcg       540
     cacggtcacg acctcaatct gcgctcggcc tacgtgcacg tgctggccga cgccgccacc       600
     tcggtgctgg ccatcgtcgc cctgcttggc ggcaagctgc tgggcctgac ctggctggac       660
     ccggtgatgg gcctcgtcgg cgccgtgctg gtgacggtct gggcgatcgg cctgctgcgc       720
     gacagcggcc gcatcctgct cgacgcgcag atggatgcac cggtggtggc cgaagtgcgc       780
     gaagtgatcg aacagggccc gtggccggca cgcctggccg acctgcacgt ctggcaggtg       840
     ggtcgcggca agtacgcggt cagcgctagt gtggtcacca gcgacgccag tctggatgcc       900
     gataccgtgc gcaacgcgct ggcgattcat gaggaactgg tgcacgtgac ggtggagatt       960
     caccgcagcg cctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page