(data stored in ACNUC7421 zone)

EMBL: CP001111.PE399

CP001111.PE399       Location/Qualifiers
FT   CDS_pept        474536..475861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0399"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: xom:XOO_4133 nitrile
FT                   hydratase activator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50104"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR1"
FT                   /protein_id="ACF50104.1"
FT                   /translation="MNTVSRADRRLPVTVLSGFLGAGKTTLLNQILRNREGLRVAVIVN
FT                   DMSEVNIDAQLVREGGAELRRTEETLVEFSNGCICCTLRDDLLQEVRRLADADRYDYLL
FT                   IESTGIGEPMPVAATFAVRDEHGFSLSDIARLDTMVTVVDGSAFLADFGSTLRLAERGQ
FT                   QAGPDDDRGVVDLLCEQVEFADVIVVSKVDQVDDEVLQDTLAVLRGLNRDAKLLLSSFG
FT                   DVPLAELLDTGRFDMERAQRAPGWVKELRGEHTPETEEYGIGSFVYRSRRPFHPARFAR
FT                   ALQSGMPGVIRSKGWFWLANRMDWVGELNTVGAATRTQAAGFWYAARDRVRARLEDTTP
FT                   LLPPTPLPYSDLGWARQQADCWSAPLPGLEEFPDSAAHTAMQRLWHPLWGDRRQELVVI
FT                   GVHMDERAVRAELDACLLNDQELRAGPLLWHQLPQAFPVWKR"
     atgaacactg tttcccgcgc cgaccgtcgc cttccggtca ccgtgctgtc cggcttcctc        60
     ggggccggca agaccaccct gctcaaccag atcctgcgca accgcgaggg cctgcgcgtg       120
     gcggtcatcg tcaacgacat gagcgaggtc aacatcgatg cgcagctggt gcgcgagggt       180
     ggcgccgaac tgcgccgcac cgaagagacg ctggtggagt tcagcaacgg ctgcatctgc       240
     tgcacgctac gcgacgacct gctgcaggaa gtgcggcgcc tggctgatgc ggatcgctac       300
     gactacctgc tgatcgaatc gacgggcatc ggtgaaccga tgccggtggc ggccacgttc       360
     gcggtgcgcg acgagcacgg tttcagcctg agtgatatcg cgcggctgga cacgatggtg       420
     acggtggtcg acggcagcgc attccttgcc gacttcggtt cgaccctgcg cctggccgag       480
     cgcggccagc aggccgggcc ggacgatgat cgcggtgtgg tcgacctgct gtgcgaacag       540
     gtcgagttcg ccgacgtgat cgtggtcagc aaggtggacc aggtggatga cgaagtgttg       600
     caggacacgc tggcggtact gcgtggcttg aaccgggatg cgaagctgct gctgtccagc       660
     ttcggtgatg tgccgttggc cgagctgctg gataccggtc gcttcgacat ggagcgtgcg       720
     caacgcgcgc cgggttgggt gaaggagctg cgtggcgagc acacaccgga aaccgaagag       780
     tacggcatcg gcagcttcgt ctaccgttcg cggcgtccgt tccaccccgc gcgattcgcc       840
     cgcgcgctgc agtccggcat gcccggcgtg atccgcagca agggctggtt ctggctggcc       900
     aaccgcatgg attgggtagg cgagttgaac accgtgggcg cggcgacgcg gacgcaggcg       960
     gcgggtttct ggtatgccgc gcgcgaccgc gtgcgggcta ggctggaaga caccacaccg      1020
     ttgttgccgc cgacgccgtt gccttacagc gacctgggat gggcgcggca gcaggccgat      1080
     tgctggagcg cgccgctgcc ggggcttgag gaattcccgg attcggccgc gcacacggcg      1140
     atgcagcggc tgtggcaccc attgtggggt gatcgccgcc aggagctagt ggtgattggt      1200
     gtgcacatgg acgagcgcgc ggtgcgtgcg gagctggatg cgtgccttct caacgaccag      1260
     gagctgcgtg cggggccatt gttgtggcac cagttgccgc aggcgttccc tgtgtggaag      1320
     cgttga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page