(data stored in ACNUC7421 zone)

EMBL: CP001111.PE400

CP001111.PE400       Location/Qualifiers
FT   CDS_pept        complement(475966..477573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0400"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cti:RALTA_B0293 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50105"
FT                   /db_xref="GOA:B4SHR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR2"
FT                   /protein_id="ACF50105.1"
FT                   /translation="MTPHSLTLDRVSYRLADGRVLFSDLSFSFEPVATGLVGANGTGKS
FT                   VLARLLAGRLSPDSGQVRGSDRVFLLPTPGYPPAGTVGELAGVGEALSALARIEAGSVD
FT                   EADFTCVGERWDLRERLQQQWQALGLPDDLDHAQPAARLSGGQAMQVALSGAWASGADW
FT                   LILDEPSNHLDARHRQQLYKQLQQWRGGLLAISHDRELLGRMQQIVELDARGLHRYGGA
FT                   WQHYAEVRAAEREAAAAQLDHARAQHRQQQRSAREQNERQQQRQARGNREAKQANQAPI
FT                   LLGRQKQRAEASLGRAQQVQSERLQASAEQLRAAISAVHTAPELALFAGAGERGSTRLL
FT                   QAEALVLPHGCSAPLQLEIRRGQRIAVVGDNGSGKSTLLRVLAGQLRARDGTVQRHAPL
FT                   ALLDQQLLGLSGEHSILDSVQAANPGADPGELRTRLALLGLDAQRIQRPASSLSDGERV
FT                   KGALASVLYADPAPQLLLLDEPGNALDLSALQALEELLAAWPGALMMVSHDLHLLQALR
FT                   PTQVLQVTANSWQWRDSL"
     atgaccccgc attccctcac gctcgatcgc gtgtcgtatc gattggccga cggccgagtg        60
     ctgttttccg atctgtcgtt ttccttcgaa ccggtcgcca ccggcctggt cggtgccaat       120
     ggcaccggca aaagcgtgct cgcacgcctg ctggccgggc ggctgtcgcc cgacagtggc       180
     caggtgcgtg gcagtgaccg cgtgttcctg ttgcccacac cgggctatcc accagccggc       240
     accgtgggcg agttggccgg tgtgggtgaa gcgctgtccg cgctggcacg catcgaagcc       300
     ggcagcgtcg atgaggccga cttcacctgc gtaggcgagc gctgggacct gcgcgaacgc       360
     ctgcagcagc aatggcaggc gctaggactg cccgacgatc tcgatcacgc ccagcctgcc       420
     gcacgcctca gtggcggcca ggcgatgcag gtggcgctgt ccggcgcgtg ggccagcggc       480
     gccgactggt tgatcctgga cgaacccagc aatcaccttg atgcgcgtca tcgccagcag       540
     ctgtacaagc agttgcagca atggcgcggc ggcctgctgg caatcagcca tgatcgcgaa       600
     ctgctgggcc gcatgcagca gattgtcgaa cttgatgcgc gtggcctgca tcgctatggc       660
     ggcgcgtggc agcactatgc cgaagtgcgc gccgccgaac gcgaagccgc cgccgcccag       720
     ctcgaccatg cgcgcgccca gcaccgacag cagcaacgca gcgcgcgcga gcagaacgaa       780
     cgccagcagc aacgtcaggc acgtggcaat cgcgaagcaa agcaggccaa ccaggcaccg       840
     atcctgctcg gccgccagaa gcagcgtgcc gaagccagcc ttggtcgcgc gcagcaggtg       900
     cagtcagaac gcctgcaggc cagtgcagag cagctgcgtg cagcgatatc cgcggttcac       960
     accgcgccgg aactggcgct gtttgccggt gcgggggaac gtggcagcac gcgcctgctg      1020
     caggccgagg ccttggtgct gccgcatggc tgcagtgccc cgttgcagct ggagatccgt      1080
     cgcggccagc gcatcgccgt ggtcggtgac aacggcagtg gcaaatccac cctgctgcgt      1140
     gtgctggccg gccagctgcg agcgcgcgat ggcactgtgc aacgccacgc gccactggcg      1200
     ctgcttgacc agcaactgct gggattgtcc ggcgagcaca gcatcctcga tagcgtacag      1260
     gccgccaatc cgggggcgga cccgggcgaa ctgcgcactc ggctcgcact actgggtctg      1320
     gacgcacagc gcatccagcg ccccgccagc agcctcagcg atggcgaacg ggtgaagggg      1380
     gcgttggcaa gcgtgctcta cgccgatccc gcgccgcagc tgttgctgct ggacgagccc      1440
     ggcaatgcac tggacctaag cgcattgcag gcactggagg aactgctggc ggcatggccg      1500
     ggtgccttga tgatggtcag ccacgacctg catctgctgc aggcattgcg gccgacgcag      1560
     gtattgcagg tcaccgccaa cagctggcaa tggcgcgaca gtctgtag                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page