(data stored in ACNUC7421 zone)

EMBL: CP001111.PE404

CP001111.PE404       Location/Qualifiers
FT   CDS_pept        complement(481619..483235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0404"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein; KEGG: swi:Swit_2925 EAL
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50109"
FT                   /db_xref="GOA:B4SIA4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA4"
FT                   /protein_id="ACF50109.1"
FT                   /translation="MSRLRIIIGGTALALLAAAVPIAVMAYATWDRAVSVEQQRLRDIA
FT                   GRALRRSDQSYHDALAALKSAEAGAHVPCSPDHIQRMQTLVMTTPSIDQMGYFEGGTLR
FT                   CTSWGPFLADVKQPKADHVTSEGAGIAVDVRPEASGRRQVLSILYGAYDVLVDPRRFVD
FT                   VIADPNVRLALASPDGRLLAKQDGMDPALLETLLRNPGEGLDHNTLYATARNGEWLAIA
FT                   TTPRTALAATFRQQAWLYVPLGLLMAAVGAGLVIWLSRRRLSLRGELATAIRRRELYLH
FT                   YQPIIELDTGICVGAEALIRWQRQDGTQVRPDLFIPLAEETGMIGAITDLVIENVVRDM
FT                   RELLVADRSAHIAINLAAEDISSGRALKLIAKHMAGSGILPQQIWMEATEHGFLDLDRA
FT                   RTMLAQARRAGHSVAIDDFGVGFSSLQYLEQLPLDALKIDKSFIDAIGTESATSPVTPH
FT                   IIDMAKELGLWVVAEGVETEAQLAYLHTRKVEFAQGWLFSRPLPRDEFVVFHQKRQQRY
FT                   GAAREHMQNPRSVPIEREGIE"
     atgagccgcc tgcgcatcat cattggtggc accgcgctgg cgctgctggc cgcagcggtg        60
     ccgatcgcgg tgatggccta tgccacctgg gaccgtgcgg tcagtgtcga gcagcagcgc       120
     ctgcgcgaca tcgccggccg cgcgctgcgc cgttccgacc agtcctacca tgacgcgctg       180
     gccgcgctga agtcggcgga ggcgggcgcc catgtgccgt gcagcccgga ccatatccag       240
     cgcatgcaga ccctggtgat gaccacgccg tcgatcgacc agatgggcta tttcgaaggc       300
     ggcacgctgc ggtgcacgtc gtggggcccg ttcctggccg atgtgaagca gcccaaggcc       360
     gaccatgtga ccagcgaagg ggccggcatc gcggtggacg tgcgccccga agccagcggc       420
     cgccgccagg tgctgtcgat cctgtacggc gcctacgacg tactggtcga cccgcgccgt       480
     ttcgtcgatg tcatcgcaga ccccaacgtg cgcctggccc tggccagccc ggacggccgc       540
     ctgctggcca agcaggacgg catggatccg gcgctgctgg agaccctgct gcgcaacccg       600
     ggcgaagggc tggaccacaa caccctctac gccaccgccc gcaatggcga atggctggcg       660
     atcgccacca cgccacgcac ggcactggcc gccaccttcc gccagcaggc atggctgtac       720
     gtaccgctcg ggttgctgat ggctgccgtg ggtgccggcc tggtgatctg gctgtcgcgc       780
     cgccggctgt cgctgcgcgg cgaactggcc acggcgatcc gccgccgcga gctgtacctg       840
     cactaccagc cgatcatcga actggatacc ggcatctgcg tcggcgccga agcattgatt       900
     cgctggcagc gtcaggatgg cacccaggtc cgccccgacc tgttcattcc cctggccgaa       960
     gagaccggca tgatcggcgc gatcaccgac ctggtgatcg agaacgtggt gcgcgacatg      1020
     cgcgagctgc tggtggccga ccgcagcgcg cacatcgcga tcaatctcgc cgccgaggac      1080
     atcagcagtg gtcgtgcatt gaagttgatc gccaagcaca tggccggcag cggcatcctg      1140
     ccgcagcaga tctggatgga agcgaccgag cacggcttcc tcgacctgga ccgcgcacgc      1200
     acgatgctgg cgcaggctcg ccgggccggc cacagcgtgg cgatcgatga cttcggcgtg      1260
     ggcttttcca gcctgcagta cctggagcag ctgccactgg atgcactgaa gatcgacaag      1320
     tcgttcatcg atgcgatcgg caccgagagc gccaccagcc cggtcacgcc gcacatcatc      1380
     gacatggcca aggagctggg cctgtgggtg gtcgccgagg gcgtggagac cgaggcacag      1440
     ctggcgtatc tgcatacccg gaaggtcgag ttcgcgcagg gttggctgtt ctcgcggccg      1500
     ctgccccgcg atgagttcgt ggtgtttcat cagaaacggc agcagcgcta tggcgcggcg      1560
     cgggagcaca tgcagaaccc gcggagcgtg ccgatcgagc gtgaggggat cgagtag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page